SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g11550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g11550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g11550

Feature Type:gene_model
Chromosome:Gm07
Start:9739096
stop:9743292
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73590AT Annotation by Michelle Graham. TAIR10: Auxin efflux carrier family protein | chr1:27659772-27662876 FORWARD LENGTH=622 SoyBaseE_val: 0ISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010229GO-bp Annotation by Michelle Graham. GO Biological Process: inflorescence development SoyBaseN/AISS
GO:0010338GO-bp Annotation by Michelle Graham. GO Biological Process: leaf formation SoyBaseN/AISS
GO:0010358GO-bp Annotation by Michelle Graham. GO Biological Process: leaf shaping SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0016310GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorylation SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0048826GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon morphogenesis SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009925GO-cc Annotation by Michelle Graham. GO Cellular Compartment: basal plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0045177GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apical part of cell SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF03547PFAM Membrane transport protein JGI ISS
UniRef100_B9I2E8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin efflux carrier component n=1 Tax=Populus trichocarpa RepID=B9I2E8_POPTR SoyBaseE_val: 0ISS
UniRef100_I1KJ54UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJ54_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g11550 not represented in the dataset

Glyma07g11550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g30700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g102500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g11550.1   sequence type=CDS   gene model=Glyma07g11550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCACCTTAACAGACTTCTACCATGTCATGACTGCAATGGTGCCACTCTATGTGGCCATGATACTAGCCTATGGCTCAGTGAAGTGGTGGAAGATTTTCTCCCCTGACCAATGCTCTGGCATCAACCGTTTTGTGGCACTCTTTGCAGTGCCTCTTCTCTCCTTCCACTTCATAGCCTCCAACAACCCTTACGAAATGAACCTCAGGTTCCTAGCTGCTGACACCCTTCAAAAGATCATAATACTAGTCCTCCTTGCAGTTTGGAGCAACATCGCCAAAAGGGGTTGCTTGGAATGGGCCATAACCTTGTTCTCTCTCTCCACCCTCCCTAACACTTTGGTCATGGGCATCCCTTTGCTCAAAGGGATGTATGGTGACTTCTCAGGGTCCCTTATGGTGCAAATTGTGGTCCTCCAGTGTATCATTTGGTACACCTTGATGCTGTTCTTGTTTGAGTTTAGAGGTGCCAGAATGCTTATCTCTGAGCAGTTCCCTGACACTGCTGGCTCCATTGTCTCCATCCATGTTGACTCTGATGTCATGTCATTGGATGGAAGGCAACCACTTGAGACTGAAGCTGAGATCAAGGAAGATGGTAAACTCCATGTCACTGTGAGGAAGTCCAATGCCTCAAGATCAGACATCTTCTCAAGAAGGTCTCAGGGTCTCTCTTCCACCACTCCACGCCCTTCTAACCTCACTAATGCTGAGATATATTCTTTGCAATCCTCTAGGAACCCTACACCGAGAGGTTCCAGCTTCAACCACACTGATTTCTACTCTATGATGGCTGCTGGTGGCAGGAACTCCAACTTTGGTGCCTCTGATGTTTATGGCCTTTCAGCCTCAAGAGGGCCAACTCCAAGGCCTTCTAACTATGATGAAGATGGTGGGAAGCCAAAGTTCCATTACCATGCTGGTGGAACTGGACACTACCCTGCACCAAACCCTGGCATGTTCTCTCCCTCAAATGGGTCCAAAAGTGTTGCTGCTGCTAATGCTAATGCTAATGCCAAAAGGCCTAATGGGCAGGCTCAGCTGAAGCCTGAGGATGGGAATAGGGACCTTCATATGTTTGTTTGGAGTTCAAGTGCTTCACCAGTCTCTGACGTGTTTGGTGCCCATGAGTATGGAGGTCATGATCAGAAAGAAGTCAAATTGAATGTATCTCCAGGGAAAGTGGAGAATCATAGGGACACTCAAGAAGACTACCTAGAGAAAGATGAGTTCAGCTTTGGGAATAGAGGAATGGATAGGGAGATGAATCAGCTTGAAGGTGAGAAGGTTGGAGATGGGAAGCCAAAAACCATGCCTCCAGCAAGTGTGATGACAAGGCTTATATTGATTATGGTGTGGAGAAAACTCATCAGAAACCCCAACACCTACTCTAGCCTAATTGGCCTCACTTGGTCTCTTGTTTCATTCAAGTGGAATGTGGAGATGCCTGCCATAATAGCAAAGTCTATCTCCATATTGTCAGATGCAGGGCTTGGCATGGCCATGTTCAGTCTTGGTCTCTTCATGGCTTTGCAACCGAGGGTCATAGCATGTGGAAATTCCACCGCAGCTTTTGCCATGGCTGTGAGATTCCTTACAGGTCCAGCTGTCATGGCAGCTGCTTCCGTTGCTGTTGGACTCAAAGGTGTTCTCCTACATGTTGCCATTGTTCAGGCAGCTCTTCCCCAAGGAATTGTCCCATTTGTCTTTGCTAAGGAATATAATGTACATCCTGATATTCTCAGCACAGCTGTTATTTTTGGGATGTTGATTGCTTTGCCCATAACTCTAGTGTACTACATCTTGTTGGGGTTGTGA

>Glyma07g11550.1   sequence type=predicted peptide   gene model=Glyma07g11550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIASNNPYEMNLRFLAADTLQKIIILVLLAVWSNIAKRGCLEWAITLFSLSTLPNTLVMGIPLLKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEFRGARMLISEQFPDTAGSIVSIHVDSDVMSLDGRQPLETEAEIKEDGKLHVTVRKSNASRSDIFSRRSQGLSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHTDFYSMMAAGGRNSNFGASDVYGLSASRGPTPRPSNYDEDGGKPKFHYHAGGTGHYPAPNPGMFSPSNGSKSVAAANANANAKRPNGQAQLKPEDGNRDLHMFVWSSSASPVSDVFGAHEYGGHDQKEVKLNVSPGKVENHRDTQEDYLEKDEFSFGNRGMDREMNQLEGEKVGDGKPKTMPPASVMTRLILIMVWRKLIRNPNTYSSLIGLTWSLVSFKWNVEMPAIIAKSISILSDAGLGMAMFSLGLFMALQPRVIACGNSTAAFAMAVRFLTGPAVMAAASVAVGLKGVLLHVAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITLVYYILLGL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo