SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g11340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g11340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g11340

Feature Type:gene_model
Chromosome:Gm07
Start:9518328
stop:9520559
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48630AT Annotation by Michelle Graham. TAIR10: receptor for activated C kinase 1B | chr1:17981977-17983268 REVERSE LENGTH=326 SoyBaseE_val: 6.00E-134ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0071215GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to abscisic acid stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
KOG0279 KOG G protein beta subunit-like protein JGI ISS
PTHR19868Panther RECEPTOR FOR ACTIVATED PROTEIN KINASE C (RACK1) JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_I1KJ39UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJ39_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9C4Z6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Guanine nucleotide-binding protein subunit beta-like protein B n=1 Tax=Arabidopsis thaliana RepID=GPLPB_ARATH SoyBaseE_val: 3.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g11340 not represented in the dataset

Glyma07g11340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g100800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g11340.1   sequence type=CDS   gene model=Glyma07g11340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGAGGCAGAGGTTTTCGTCTTCCGAGGAACACTGCGTGGCCACACCGACACTGTCACCGCAATAGCCACCCCAGAGAACAACAACAACAACTCCGACAAAATCATCGTCAGTTCCTCCCGTGACAATTCCTTAATCGTGTGGCGCCTCACTAAGGAATACTCAAACTCTTACGGTGTTCTCCACCGCAGGCTAACCGGTCACTCTCACTTTGTCAGCGATGTCGCTTTATCCTCCGACGCCGATTTCGCCGTCTCCGCCTCCTGGGACGGCGAGCTCCGCCTCTGGGACCTCTCCACCGGCGCCACCAAGCTCCGCTTCATCGGTCACGCCAAGGACGTCCTCTCCGTCGCGCTCTTGAACGACAGTGTTATAATTTCCGGCTCACGTGACCACACCATCAAGGCGTGGAACACGTGCGGCACGTGCATGTCGACGGTGGACAACGGCAGCGGTGACGGTCACACGGATTGGGTTTCATGCGTGCGGTTCATTCCGGACGCGGCGCCACCGAGGTTGGTGTCGGCGTCGTGGGACGGGAGCGTTAGGGTTTGGGACGTGGACGTGGACGTGGACAAGGGCGCGTTGAGGAAGAGGTTTACTCTCTCCGGGCACGAGGGTTACGTGAACGTGGTGGCGGTGTCACCGGACGCGTCGTTGGTTGCGAGTGGGGGAAAGGATGGGGTGGTGCTGCTGTGGGATATGGCGGGTGGGGTGAAGATTTATGAGTTTGAGGTTGGTTCGGTTGTGCATGGGTTGTGGTTTTCTCCAAACAGGTATTGGATGTGTATTGCCACGGATGAGAGTGTTAGGGTTTGGGATTTGGAGAGTAATAGCATTATAAAGGATTTGAATGTCAATGGTAACAACGACCACTACAATTATGTCAATGGTGGGACTGAGATCACTGCCAACAACAAGGATATTTATTGCACGAGTATGAATTGGGATGCTGATGGGAACACGTTGTTCTGTGGTTACACCGACGGTCTAATCAGAATATGGGAAGTCATTAGCTGA

>Glyma07g11340.1   sequence type=predicted peptide   gene model=Glyma07g11340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTEAEVFVFRGTLRGHTDTVTAIATPENNNNNSDKIIVSSSRDNSLIVWRLTKEYSNSYGVLHRRLTGHSHFVSDVALSSDADFAVSASWDGELRLWDLSTGATKLRFIGHAKDVLSVALLNDSVIISGSRDHTIKAWNTCGTCMSTVDNGSGDGHTDWVSCVRFIPDAAPPRLVSASWDGSVRVWDVDVDVDKGALRKRFTLSGHEGYVNVVAVSPDASLVASGGKDGVVLLWDMAGGVKIYEFEVGSVVHGLWFSPNRYWMCIATDESVRVWDLESNSIIKDLNVNGNNDHYNYVNGGTEITANNKDIYCTSMNWDADGNTLFCGYTDGLIRIWEVIS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo