Glyma07g10496 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g10496

Feature Type:	gene_model
Chromosome:	Gm07
Start:	8777162
stop:	8777440
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g10496

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G38260	AT	Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein \| chr5:15283692-15285837 REVERSE LENGTH=638	SoyBase	E_val: 3.00E-19	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF441	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7KMN1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Kinase R-like protein n=1 Tax=Medicago truncatula RepID=G7KMN1_MEDTR	SoyBase	E_val: 1.00E-31	ISS
UniRef100_I1L4A8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L4A8_SOYBN	SoyBase	E_val: 8.00E-50	ISS

Expression Patterns of Glyma07g10496

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g10496 not represented in the dataset	Glyma07g10496 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g10496 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma07g10496

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g10496

Limit To All Plant Sequences

>Glyma07g10496.1   sequence type=CDS   gene model=Glyma07g10496   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATATTAATGCGAAAGCAAGTCACACAAGTGAGATATACTTCCCACATTGGGTCTGCAACAGGCTAGAGCAGGGTGGAGATTGGAGACCTAACGGGGTGATAGTGACGGAAGAAAACGAGATAGTAAAAAGAATGACTGTAGTGGGTTTATGGTGTGTTCAAACCTTTCCAAAGGATAGACCTACTATGACTAGAGTAGTAGATATGCTAGAAGGCAAAACAAATTCTCGAGAAATTCCCCAAAACCTGCCCTTTCTTCTCCCACTAGGTCAATGCTAG

Predicted protein sequences of Glyma07g10496

Limit To All Plant Sequences

>Glyma07g10496.1   sequence type=predicted peptide   gene model=Glyma07g10496   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NINAKASHTSEIYFPHWVCNRLEQGGDWRPNGVIVTEENEIVKRMTVVGLWCVQTFPKDRPTMTRVVDMLEGKTNSREIPQNLPFLLPLGQC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain