SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g10381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g10381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g10381

Feature Type:gene_model
Chromosome:Gm07
Start:8671164
stop:8672145
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G66950AT Annotation by Michelle Graham. TAIR10: pleiotropic drug resistance 11 | chr1:24978239-24984461 FORWARD LENGTH=1454 SoyBaseE_val: 5.00E-28ISS
GO:0000302GO-bp Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species SoyBaseN/AISS
GO:0006855GO-bp Annotation by Michelle Graham. GO Biological Process: drug transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
GO:0042626GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances SoyBaseN/AISS
PTHR19241Panther ATP-BINDING CASSETTE TRANSPORTER JGI ISS
PTHR19241:SF10Panther ATP-BINDING CASSETTE TRANSPORTER-RELATED JGI ISS
UniRef100_G7L5Z8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pleiotropic drug resistance protein n=1 Tax=Medicago truncatula RepID=G7L5Z8_MEDTR SoyBaseE_val: 1.00E-30ISS
UniRef100_UPI000233F5EEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F5EE related cluster n=1 Tax=unknown RepID=UPI000233F5EE SoyBaseE_val: 1.00E-36ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g10381 not represented in the dataset

Glyma07g10381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g093500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g10381.1   sequence type=CDS   gene model=Glyma07g10381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGAAAGAATCTTCAGAAATGGCCAGTTCTTTGAACCAAGAACCAAGAAAGGGAATGATTCTACCATTTCAACCTCTTTCACTTGCATTCAATCATATTAGCTATTATGTAGATATGTCAGCTTTCGCATATGCTTTCCTTACACTGGCATATCAACTTCAACTACTGCAAGATGTTAGTGGTGCTTTTAGACCAGGAATTTTGACAACACTTGTGGATGTATTTGCTGGAAGAAAAATAGGTGGATACATTGAAGGAAGTATTACCATCTGA

>Glyma07g10381.1   sequence type=predicted peptide   gene model=Glyma07g10381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVKESSEMASSLNQEPRKGMILPFQPLSLAFNHISYYVDMSAFAYAFLTLAYQLQLLQDVSGAFRPGILTTLVDVFAGRKIGGYIEGSITI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo