SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g09770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g09770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g09770

Feature Type:gene_model
Chromosome:Gm07
Start:8230934
stop:8231745
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g09770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G19420AT Annotation by Michelle Graham. TAIR10: Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain | chr5:6547945-6552866 REVERSE LENGTH=1105 SoyBaseE_val: 2.00E-14ISS
GO:0000956GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003682GO-mf Annotation by Michelle Graham. GO Molecular Function: chromatin binding SoyBaseN/AISS
GO:0005543GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0008536GO-mf Annotation by Michelle Graham. GO Molecular Function: Ran GTPase binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
UniRef100_I1KHD7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KHD7_SOYBN SoyBaseE_val: 2.00E-15ISS
UniRef100_Q84RS0UniRef Annotation by Michelle Graham. Most informative UniRef hit: ZR4 protein (Fragment) n=1 Tax=Medicago sativa RepID=Q84RS0_MEDSA SoyBaseE_val: 5.00E-15ISS

Expression Patterns of Glyma07g09770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g09770 not represented in the dataset
Glyma07g09770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g09770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g088800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g09770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g09770
>Glyma07g09770.1   sequence type=CDS   gene model=Glyma07g09770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCAGAAAGCCCAGCTTCAAGAAGTTGAGTTGGAAAGAACAAGTAAACAGTTAAAAGAAGCAATAGCAATACAGCAAAGCGAAGAAACTGCCAAATGCAAAGCAGCAAAGGAATTGATCAAGTCACTCATTGCCCAGCCTAGAGAAGAATTCAGCGATTGGCCTCATGGTTTACTAGCAATTGGAACATTTGGAAACAAGAGTGAAATCAAAGCAGACTTAGACGAGAAAAATACACAAGAGGATCACTATAAGGGTAAAGCGACAAACCTAACTTGGACAGAAGAAAAACCTAGGGCACGGCGGGGCGCACGGCGCACAATGCTTCGAAGCCAACCGCGAAACAGGCAACCACGAAACACGGCGCACAGGATGTCAGCTTCCAGCAGGTCCTTCGAGGTTCAGAGCTTCCAAAACCGCTTAAATTGTACGTCCTAA
Predicted protein sequences of Glyma07g09770
>Glyma07g09770.1   sequence type=predicted peptide   gene model=Glyma07g09770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTQKAQLQEVELERTSKQLKEAIAIQQSEETAKCKAAKELIKSLIAQPREEFSDWPHGLLAIGTFGNKSEIKADLDEKNTQEDHYKGKATNLTWTEEKPRARRGARRTMLRSQPRNRQPRNTAHRMSASSRSFEVQSFQNRLNCTS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo