SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g09480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g09480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g09480

Feature Type:gene_model
Chromosome:Gm07
Start:7902671
stop:7905178
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18830AT Annotation by Michelle Graham. TAIR10: polyol/monosaccharide transporter 5 | chr3:6489000-6491209 REVERSE LENGTH=539 SoyBaseE_val: 0ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005351GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity SoyBaseN/AISS
GO:0005354GO-mf Annotation by Michelle Graham. GO Molecular Function: galactose transmembrane transporter activity SoyBaseN/AISS
GO:0005355GO-mf Annotation by Michelle Graham. GO Molecular Function: hexose phosphate transport SoyBaseN/AISS
GO:0005365GO-mf Annotation by Michelle Graham. GO Molecular Function: myo-inositol transmembrane transporter activity SoyBaseN/AISS
GO:0015144GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity SoyBaseN/AISS
GO:0015145GO-mf Annotation by Michelle Graham. GO Molecular Function: monosaccharide transmembrane transporter activity SoyBaseN/AISS
GO:0015148GO-mf Annotation by Michelle Graham. GO Molecular Function: D-xylose transmembrane transporter activity SoyBaseN/AISS
GO:0015168GO-mf Annotation by Michelle Graham. GO Molecular Function: glycerol transmembrane transporter activity SoyBaseN/AISS
GO:0015575GO-mf Annotation by Michelle Graham. GO Molecular Function: mannitol transmembrane transporter activity SoyBaseN/AISS
GO:0015576GO-mf Annotation by Michelle Graham. GO Molecular Function: sorbitol transmembrane transporter activity SoyBaseN/AISS
GO:0015591GO-mf Annotation by Michelle Graham. GO Molecular Function: D-ribose transmembrane transporter activity SoyBaseN/AISS
GO:0022857GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity SoyBaseN/AISS
KOG0254 KOG Predicted transporter (major facilitator superfamily) JGI ISS
PTHR24063Panther FAMILY NOT NAMED JGI ISS
PTHR24063:SF85Panther SUBFAMILY NOT NAMED JGI ISS
PF00083PFAM Sugar (and other) transporter JGI ISS
UniRef100_G7KPV5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Myo-inositol transporter n=1 Tax=Medicago truncatula RepID=G7KPV5_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1L4I4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L4I4_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g09480 not represented in the dataset

Glyma07g09480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g32340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g086000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g09480.2   sequence type=CDS   gene model=Glyma07g09480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGAATTCTGCTCTGGAACACCATTGTTACTACCCTCTTCCTGCTTCTGCTGCAAAAGCTGATCATCCCAATCATAATGATGGTGAAAAAGAAGAAACTTGTGCAGAGGAAGGTAGCTCTCAACATCAGCCTAACACATCACAGAATTGTGTTTCATACCAAAGCAATAAGCCTCGCCTCAACAGATATGCACTTGGTGGTGCTATCTTGGCTTCCACAAACTCCATCCTCTTAGGCTATGATATTGGGGTCATGAGTGGTGCTTCTCTTTTAATAAGGCAAGATCTAAAGATCACATCAGTCCAAGTAGAAATCCTTGTTGGGTGCTTAAATGTGTGTTCCCTGATAGGATCTCTTGCTTCAGGCAAGACCTCTGATTGGATTGGGAGAAGGTACACCATAATGGTTGCTGCAGCAACATTCCTGATTGGTGCTATTCTGATGGGTTTGGCCCCTTCATTCCCATTCCTAATGGCAGGTCGTGTAGTTGCAGGCATTGGTGTTGGTTACTCCCTCATGATCTCACCAGTGTATGTGGCTGAGCTCTCTCCTGCTCTCACCAGAGGCTTTCTCACATCACTCCCTGAAGTCTTCATCAGTGTTGGAATTCTACTTGGTTATGTCTCCAACTATGCCTTCTCAGGTCTCCCAAATGGCATCAACTGGAGACTCATGCTTGGCCTTGCAGCCTTGCCATCAATTGCAGTGGCACTTGGTGTGTTGGCAATGCCCGAGTCGCCTCGTTGGCTTGTAGTGAAAGGAAGGTTTGAGGAAGCAAAGCAGGTTTTGATTAGAACATCAGAGAACAAAGGAGAAGCTGAATTGAGGCTTGCTGAGATACAAGAAGCTGCTGCTGCTTCTGCTTCCATCACAAACATGGACAAAGCAACAACTTCTGATGGTTCTTTTAATGGACAAGGGGTTTGGAAGGAGTTGCTTGTTACACCTACTAGCCCTGTGTTGAGAATTCTTGTGGTTGCTATTGGTGTTAACTTCTTCATGCAGGCTTCTGGGAATGATGCTGTCATGTATTATAGCCCAGAAGTGTTTAAGGAGGCTGGGATTAAGGATGAGAAGCAGCTTTTTGGTGTTACAATCATCATGGGAATAGCCAAGACTTGCTTTGTTTTGATATCAGCCTTGTTCTTGGACCCGGTTGGGAGGAGGCCCATGTTGTTGTTGGGCTCATGTGGCATGGCAATCTCATTGTTTGTGCTGGGCTTGGGCTGTACCTTGCTTAAGTTATCTGGTGATAACAAGGATGAATGGGTCATTGCTTTGTGTGTGGTTGCTGTCTGTGCTACAGTATCATTCTTTTCTATTGGGCTTGGGCCTACAACTTGGGTCTACTCTTCAGAGATTTTCCCTTTGAGGCTAAGGGCCCAAGGTTCCAGCTTGGCCATTTCTGTGAACCGTTTGATGAGTGGGATTGTGTCCATGACATTCCTTAGTGTTTCAGAGGCAATAACATTTGGAGGCATGTTCTTTGTGCTTTGTGGGGTGATGGTGTGTGCCACACTTTTCTTTTATTTCTTTTTACCAGAGACCAAAGGCAAAAGCTTAGAAGAGATTGAAGCTTTGTTTGAAGATCAAGCACATTGA

>Glyma07g09480.2   sequence type=predicted peptide   gene model=Glyma07g09480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEENSALEHHCYYPLPASAAKADHPNHNDGEKEETCAEEGSSQHQPNTSQNCVSYQSNKPRLNRYALGGAILASTNSILLGYDIGVMSGASLLIRQDLKITSVQVEILVGCLNVCSLIGSLASGKTSDWIGRRYTIMVAAATFLIGAILMGLAPSFPFLMAGRVVAGIGVGYSLMISPVYVAELSPALTRGFLTSLPEVFISVGILLGYVSNYAFSGLPNGINWRLMLGLAALPSIAVALGVLAMPESPRWLVVKGRFEEAKQVLIRTSENKGEAELRLAEIQEAAAASASITNMDKATTSDGSFNGQGVWKELLVTPTSPVLRILVVAIGVNFFMQASGNDAVMYYSPEVFKEAGIKDEKQLFGVTIIMGIAKTCFVLISALFLDPVGRRPMLLLGSCGMAISLFVLGLGCTLLKLSGDNKDEWVIALCVVAVCATVSFFSIGLGPTTWVYSSEIFPLRLRAQGSSLAISVNRLMSGIVSMTFLSVSEAITFGGMFFVLCGVMVCATLFFYFFLPETKGKSLEEIEALFEDQAH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo