SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g09240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g09240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g09240

Feature Type:gene_model
Chromosome:Gm07
Start:7713586
stop:7715628
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G65980AT Annotation by Michelle Graham. TAIR10: thioredoxin-dependent peroxidase 1 | chr1:24559524-24560753 REVERSE LENGTH=162 SoyBaseE_val: 5.00E-94ISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016209GO-mf Annotation by Michelle Graham. GO Molecular Function: antioxidant activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0541 KOG Alkyl hydroperoxide reductase/peroxiredoxin JGI ISS
PTHR10430Panther PEROXIREDOXIN-5 JGI ISS
PF08534PFAM Redoxin JGI ISS
UniRef100_B3GV28UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxiredoxin n=1 Tax=Pisum sativum RepID=B3GV28_PEA SoyBaseE_val: 6.00E-106ISS
UniRef100_C6SWE0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWE0_SOYBN SoyBaseE_val: 3.00E-112ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g09240 not represented in the dataset

Glyma07g09240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g32540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g084100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g09240.1   sequence type=CDS   gene model=Glyma07g09240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCAATTGCAGTGGGAGATGTCATTCCAGACGGCATTTTGGCTTACTTGGATGAAGAAAACAAACCCCAAACTGTCTCTATTCACTCTCTCGCCGCCGGCAAGAAAGTCATCATCTTTGGGGTTCCCGGTGCCTTCACTCCTACATGCAGCTTGAAGCACGTGCCTGGCTTCATTGAGAGAGCAGAAGAGCTGAAAGGAAAGGGTGTGGACGAAATAATCTGTATCAGCGTGAATGATCCCTTTGTGATGAACTCATGGGCCAAAACGTTCCCAGAGAACAAGCATGTTAAGTTCCTTGCTGATGGTGCAGCCAAATACACCAATGCCCTCGGTCTTGAGCTTGACCTCACCGACAAGGGTCTCGGCGTCCGCTCAAAGAGGTTTGCTTTGCTGGTGGAAGACCTCAAGGTGAAGGTTGCAAATGTTGAAAGTGGAGGAGAGTTCACCATCTCCAGTGCTGAAGAGATCATCAAGGCCCTCTAA

>Glyma07g09240.1   sequence type=predicted peptide   gene model=Glyma07g09240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPIAVGDVIPDGILAYLDEENKPQTVSIHSLAAGKKVIIFGVPGAFTPTCSLKHVPGFIERAEELKGKGVDEIICISVNDPFVMNSWAKTFPENKHVKFLADGAAKYTNALGLELDLTDKGLGVRSKRFALLVEDLKVKVANVESGGEFTISSAEEIIKAL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo