SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G61140 | AT | Annotation by Michelle Graham. TAIR10: 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain | chr3:22626335-22628895 FORWARD LENGTH=441 | SoyBase | E_val: 0 | ISS |
| GO:0000003 | GO-bp | Annotation by Michelle Graham. GO Biological Process: reproduction | SoyBase | N/A | ISS |
| GO:0000085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle | SoyBase | N/A | ISS |
| GO:0000338 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein deneddylation | SoyBase | N/A | ISS |
| GO:0006325 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin organization | SoyBase | N/A | ISS |
| GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS |
| GO:0007131 | GO-bp | Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009646 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to absence of light | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009880 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0010072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010431 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed maturation | SoyBase | N/A | ISS |
| GO:0010564 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process | SoyBase | N/A | ISS |
| GO:0010638 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0016571 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone methylation | SoyBase | N/A | ISS |
| GO:0016579 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein deubiquitination | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0033044 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization | SoyBase | N/A | ISS |
| GO:0045595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0048366 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf development | SoyBase | N/A | ISS |
| GO:0048825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cotyledon development | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0051301 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell division | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0008180 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: signalosome | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| KOG0686 | KOG | COP9 signalosome, subunit CSN1 | JGI | ISS | |
| PTHR14145 | Panther | 26S PROTESOME SUBUNIT 6 | JGI | ISS | |
| PTHR14145:SF2 | Panther | COP9 SIGNALOSOME COMPLEX SUBUNIT 1 | JGI | ISS | |
| PF01399 | PFAM | PCI domain | JGI | ISS | |
| PF10602 | PFAM | 26S proteasome subunit RPN7 | JGI | ISS | |
| UniRef100_B9RDL0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cop9 signalosome complex subunit, putative n=1 Tax=Ricinus communis RepID=B9RDL0_RICCO | SoyBase | E_val: 0 | ISS |
| UniRef100_I1KIH3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KIH3_SOYBN | SoyBase | E_val: 0 | ISS |
|
Glyma07g08370 not represented in the dataset |
Glyma07g08370 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma03g01880 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g077100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g08370.1 sequence type=CDS gene model=Glyma07g08370 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACGGCGACGACGAGACCTCGGGTCCGATGATCGACGAAATCTACGCCAACGGCGGTGGCGTCGGCGACGACGGAGACAAGCGGAGCCGCCGCGCAATCATGAGCGGCGACCAGCTCGACATCGAGGCGTACGCGGCGCTATACTCGGGGCGCACGAAGATCATGAGGCTCCTCTTCTTCGCCGACAAGATGAACAACGCGGCGACGCAGCTCGAGGCGCTGCGCATGGCCTACGACGAGATTAAGAAGGGAGAGAACACGCAGCTGTTCAGGGAGGTCGTGCAGAAGATCGACGGGAGGCTGGGCCCGAACTACGACATGGACGCGGCATGGTGCGACACCGTGGATCGGAGAGCTGAGCAGAAGAAGGAGAAGCTCGAGAACGAACTCAATGCCTATAGGACAAACTTGATTAAGGAAAGCATTAGGATGGGATTCAATGATTTTGGAGACTTTTACTATGCTCATGGTCAATTGGGGGACGCTTTTAAAAGTTATGTCCGTACTCGGGATTATTGCACTACATCAAAGCACATTATTCATATGTGTATGAGTGCAATTCTGGTCAGCATTGAGATGGGTCAATTTTCTCATGTTACAAGCTATGTTAGCAAGGCAGAACAGGCACCAGATGCCCCTGAAGCAGTAACAGTTGCAAAGCTACGATGTGCTGCAGGATTGGCTAATCTAGAGGCCAAAAAGTACAAGCTTGCTGCCCGAAAGTTTCTAGAAACAGGACCTGAACTGGGAAGTCACTATAATGACGTAATTGCATCTCAAGATGTTGCAACATATGGAGGACTTTGTGCACTTGCAACATTTGATCGGGCAGAGTTAAAGAGCAAAGTTATAGACAATTCCAACTTCCGCAATTTCTTAGAGTTAGTACCTGAAGTAAGGGAACTGATAAATGATTTTTACTCAAGTCACTATGCTTCATGTCTGGAATACCTCGGGAACCTCAAAGCAAACCTATTGCTTGATATACATTTGCATGACCATGTTGAGACACTTTATGATCAAATTCGTCACAAAGCCCTTATCCAGTACACACACCCATTTGTGTCTGTTGATTTGAACATGATGGCTAATGCATTCAAGACAACTGTTGCTGGACTTGAGAAAGAACTAGAAGCACTGATTACTGATAATCAGATACAGGCTCGAATTGATTCGCACAACAAAATTTTGTATGCGCGGCATGCAGATCAAAGGAATGCCACCTTTCAAAGGGTTCTGGAAACTGGAAGGGAATTTGATCGTGATGTTCGTTCCATGTTACTGAGATCAAATCTTATCAAGCATGAGTTCAATCTTAGAGCATTACGGAAACTTTGA
>Glyma07g08370.1 sequence type=predicted peptide gene model=Glyma07g08370 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDGDDETSGPMIDEIYANGGGVGDDGDKRSRRAIMSGDQLDIEAYAALYSGRTKIMRLLFFADKMNNAATQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPNYDMDAAWCDTVDRRAEQKKEKLENELNAYRTNLIKESIRMGFNDFGDFYYAHGQLGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFSHVTSYVSKAEQAPDAPEAVTVAKLRCAAGLANLEAKKYKLAARKFLETGPELGSHYNDVIASQDVATYGGLCALATFDRAELKSKVIDNSNFRNFLELVPEVRELINDFYSSHYASCLEYLGNLKANLLLDIHLHDHVETLYDQIRHKALIQYTHPFVSVDLNMMANAFKTTVAGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLETGREFDRDVRSMLLRSNLIKHEFNLRALRKL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
