SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g08370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g08370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g08370

Feature Type:gene_model
Chromosome:Gm07
Start:6988122
stop:6993788
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61140AT Annotation by Michelle Graham. TAIR10: 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain | chr3:22626335-22628895 FORWARD LENGTH=441 SoyBaseE_val: 0ISS
GO:0000003GO-bp Annotation by Michelle Graham. GO Biological Process: reproduction SoyBaseN/AISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000338GO-bp Annotation by Michelle Graham. GO Biological Process: protein deneddylation SoyBaseN/AISS
GO:0006325GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin organization SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016579GO-bp Annotation by Michelle Graham. GO Biological Process: protein deubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0008180GO-cc Annotation by Michelle Graham. GO Cellular Compartment: signalosome SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0686 KOG COP9 signalosome, subunit CSN1 JGI ISS
PTHR14145Panther 26S PROTESOME SUBUNIT 6 JGI ISS
PTHR14145:SF2Panther COP9 SIGNALOSOME COMPLEX SUBUNIT 1 JGI ISS
PF01399PFAM PCI domain JGI ISS
PF10602PFAM 26S proteasome subunit RPN7 JGI ISS
UniRef100_B9RDL0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cop9 signalosome complex subunit, putative n=1 Tax=Ricinus communis RepID=B9RDL0_RICCO SoyBaseE_val: 0ISS
UniRef100_I1KIH3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KIH3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g08370 not represented in the dataset

Glyma07g08370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g01880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g077100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g08370.1   sequence type=CDS   gene model=Glyma07g08370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGGCGACGACGAGACCTCGGGTCCGATGATCGACGAAATCTACGCCAACGGCGGTGGCGTCGGCGACGACGGAGACAAGCGGAGCCGCCGCGCAATCATGAGCGGCGACCAGCTCGACATCGAGGCGTACGCGGCGCTATACTCGGGGCGCACGAAGATCATGAGGCTCCTCTTCTTCGCCGACAAGATGAACAACGCGGCGACGCAGCTCGAGGCGCTGCGCATGGCCTACGACGAGATTAAGAAGGGAGAGAACACGCAGCTGTTCAGGGAGGTCGTGCAGAAGATCGACGGGAGGCTGGGCCCGAACTACGACATGGACGCGGCATGGTGCGACACCGTGGATCGGAGAGCTGAGCAGAAGAAGGAGAAGCTCGAGAACGAACTCAATGCCTATAGGACAAACTTGATTAAGGAAAGCATTAGGATGGGATTCAATGATTTTGGAGACTTTTACTATGCTCATGGTCAATTGGGGGACGCTTTTAAAAGTTATGTCCGTACTCGGGATTATTGCACTACATCAAAGCACATTATTCATATGTGTATGAGTGCAATTCTGGTCAGCATTGAGATGGGTCAATTTTCTCATGTTACAAGCTATGTTAGCAAGGCAGAACAGGCACCAGATGCCCCTGAAGCAGTAACAGTTGCAAAGCTACGATGTGCTGCAGGATTGGCTAATCTAGAGGCCAAAAAGTACAAGCTTGCTGCCCGAAAGTTTCTAGAAACAGGACCTGAACTGGGAAGTCACTATAATGACGTAATTGCATCTCAAGATGTTGCAACATATGGAGGACTTTGTGCACTTGCAACATTTGATCGGGCAGAGTTAAAGAGCAAAGTTATAGACAATTCCAACTTCCGCAATTTCTTAGAGTTAGTACCTGAAGTAAGGGAACTGATAAATGATTTTTACTCAAGTCACTATGCTTCATGTCTGGAATACCTCGGGAACCTCAAAGCAAACCTATTGCTTGATATACATTTGCATGACCATGTTGAGACACTTTATGATCAAATTCGTCACAAAGCCCTTATCCAGTACACACACCCATTTGTGTCTGTTGATTTGAACATGATGGCTAATGCATTCAAGACAACTGTTGCTGGACTTGAGAAAGAACTAGAAGCACTGATTACTGATAATCAGATACAGGCTCGAATTGATTCGCACAACAAAATTTTGTATGCGCGGCATGCAGATCAAAGGAATGCCACCTTTCAAAGGGTTCTGGAAACTGGAAGGGAATTTGATCGTGATGTTCGTTCCATGTTACTGAGATCAAATCTTATCAAGCATGAGTTCAATCTTAGAGCATTACGGAAACTTTGA

>Glyma07g08370.1   sequence type=predicted peptide   gene model=Glyma07g08370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDGDDETSGPMIDEIYANGGGVGDDGDKRSRRAIMSGDQLDIEAYAALYSGRTKIMRLLFFADKMNNAATQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPNYDMDAAWCDTVDRRAEQKKEKLENELNAYRTNLIKESIRMGFNDFGDFYYAHGQLGDAFKSYVRTRDYCTTSKHIIHMCMSAILVSIEMGQFSHVTSYVSKAEQAPDAPEAVTVAKLRCAAGLANLEAKKYKLAARKFLETGPELGSHYNDVIASQDVATYGGLCALATFDRAELKSKVIDNSNFRNFLELVPEVRELINDFYSSHYASCLEYLGNLKANLLLDIHLHDHVETLYDQIRHKALIQYTHPFVSVDLNMMANAFKTTVAGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLETGREFDRDVRSMLLRSNLIKHEFNLRALRKL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo