SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g08020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g08020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g08020

Feature Type:gene_model
Chromosome:Gm07
Start:6662390
stop:6665120
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61230AT Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein | chr3:22664601-22665503 REVERSE LENGTH=213 SoyBaseE_val: 5.00E-106ISS
GO:0051017GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0015629GO-cc Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0051015GO-mf Annotation by Michelle Graham. GO Molecular Function: actin filament binding SoyBaseN/AISS
KOG1700 KOG Regulatory protein MLP and related LIM proteins JGI ISS
PTHR24206Panther FAMILY NOT NAMED JGI ISS
PTHR24206:SF66Panther JGI ISS
PF00412PFAM LIM domain JGI ISS
UniRef100_B9RDN9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen-specific protein SF3, putative n=1 Tax=Ricinus communis RepID=B9RDN9_RICCO SoyBaseE_val: 1.00E-109ISS
UniRef100_C6SWV0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWV0_SOYBN SoyBaseE_val: 1.00E-153ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g08020 not represented in the dataset

Glyma07g08020 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g01590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g073600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g08020.1   sequence type=CDS   gene model=Glyma07g08020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATTCACAGGAACTCTTGATAAATGCACAGCATGTGACAAGACTGTCTATGTGGTTGACTTGTTAACTCTTGAAGGAATTCCTTACCATAAAAACTGCTTCAAGTGCAGTCACTGCAAGGGATGTCTTACGATGTGCACATACTCCTCAATGGATGGAATTCTTTATTGCAAGACACATTTTGAACAGCTTTTCAAGGAATCTGGCAATTTCAGCAAGAACTTCGCAAAGTCTTCTGAGAAGCAAAATGAGTTGAATAGAACCCCCAGCAAGCTATCTTCCATGTTCAGTGGAACCCAGGACAAATGCTCAGTTTGTACAAAAACAGTATATCCTCTGGAAAAGATGACACTTGAAGGGGAATGCTTCCACAAGACTTGCTTTAGGTGTGCTCATGCAGGGTGCCCTCTCACACATTCAAACTATGCTGCCCTTGATGGTGTTCTCTACTGCAGGGTCCACTTTGCACAACTTTTCATGGAGAAAGGGAACTACAACCATGTGCTCCAAGCTGCTGCACACAGGAGGACTGGTTCCTCTACACCTCCACTACTAGAGGAGCCATCACAAGAGCCAGCACCACCAGCATCTCATGAGGACCAAACAGAAGAAGAGACACCTCTTGAATGA

>Glyma07g08020.1   sequence type=predicted peptide   gene model=Glyma07g08020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFTGTLDKCTACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGCLTMCTYSSMDGILYCKTHFEQLFKESGNFSKNFAKSSEKQNELNRTPSKLSSMFSGTQDKCSVCTKTVYPLEKMTLEGECFHKTCFRCAHAGCPLTHSNYAALDGVLYCRVHFAQLFMEKGNYNHVLQAAAHRRTGSSTPPLLEEPSQEPAPPASHEDQTEEETPLE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo