SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g07930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g07930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g07930

Feature Type:gene_model
Chromosome:Gm07
Start:6582820
stop:6584883
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G44710AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Ribosomal protein S27/S33, mitochondrial (InterPro:IPR013219); Has 101 Blast hits to 101 proteins in 55 species: Archae - 0; Bacteria - 0; Metazoa - 8; Fungi - 59; Plants - 26; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). | chr5:18041621-18042322 FORWARD LENGTH=102 SoyBaseE_val: 3.00E-52ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4844 KOG Mitochondrial ribosomal protein S27 JGI ISS
PF08293PFAM Mitochondrial ribosomal subunit S27 JGI ISS
UniRef100_I1KID1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KID1_SOYBN SoyBaseE_val: 1.00E-67ISS
UniRef100_Q013L1UniRef Annotation by Michelle Graham. Most informative UniRef hit: WGS project CAID00000000 data, contig chromosome 08 n=1 Tax=Ostreococcus tauri RepID=Q013L1_OSTTA SoyBaseE_val: 1.00E-15ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g07930 not represented in the dataset

Glyma07g07930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g01510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g072800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g07930.1   sequence type=CDS   gene model=Glyma07g07930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGTGGTAGTTTGAAGAACATGTTGAGTGAAGCAATCAATAAAGGAGTGGTGGAATCACGAGCCAGGATCTTCGGCCACCAATTGAACCCCACTGGCCAGCAAACTCCTCACAAGCTTCTCCGCATGAAGCTCTTTGGTGAAAAAGTCGCTCAGTGGTACCCTCACGACATCAAGAAAGACGATCCTCTTGTCATGGCCCGTCAAGAACAAGAACGCTTATCAAAGCTTGAAATGTTGAAGCGGCGAGGAAAAGGACCACCCAAGAAGGGCCAAGGAAGGCGTGCTGCCAAACGCAACAAATAA

>Glyma07g07930.1   sequence type=predicted peptide   gene model=Glyma07g07930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASGSLKNMLSEAINKGVVESRARIFGHQLNPTGQQTPHKLLRMKLFGEKVAQWYPHDIKKDDPLVMARQEQERLSKLEMLKRRGKGPPKKGQGRRAAKRNK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo