SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g07041): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g07041): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g07041

Feature Type:gene_model
Chromosome:Gm07
Start:5671103
stop:5671929
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g07041
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46100AT Annotation by Michelle Graham. TAIR10: Nuclear transport factor 2 (NTF2) family protein | chr2:18953326-18954467 FORWARD LENGTH=240 SoyBaseE_val: 5.00E-37ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF10184PFAM Uncharacterized conserved protein (DUF2358) JGI ISS
UniRef100_E4MXV6UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-35-H24 n=1 Tax=Eutrema halophilum RepID=E4MXV6_THEHA SoyBaseE_val: 3.00E-34ISS
UniRef100_I1MKQ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKQ9_SOYBN SoyBaseE_val: 9.00E-51ISS

Expression Patterns of Glyma07g07041
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g07041 not represented in the dataset
Glyma07g07041 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g07041
ParalogEvidenceComments
Glyma16g03450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g07041 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma07g07041
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g07041
>Glyma07g07041.1   sequence type=CDS   gene model=Glyma07g07041   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACTCAAACATGCAGCTTATGAAGTGGGAAGATTTTGAAGATAGAGGAATTGGACACTGGCGATTCAACTGTATCTTGTCCTTTCCTTGGAAGCCCATTCTTTCTGCAACTGGATACACAAAATACTACTTTGATGCACAATCTGGAAAAAGTATGCAGGTGATAAAAACTCACTGGAATGTTCCCAAAAAGGCATTGTTCAAGCAAATTCTAAGACCTAGCAGTGGATTTGGGTTAAAAGATTATGTGGATATGTGGTTGAAAGCAGTGCAGTTGAAGCTTTAA
Predicted protein sequences of Glyma07g07041
>Glyma07g07041.1   sequence type=predicted peptide   gene model=Glyma07g07041   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NSNMQLMKWEDFEDRGIGHWRFNCILSFPWKPILSATGYTKYYFDAQSGKSMQVIKTHWNVPKKALFKQILRPSSGFGLKDYVDMWLKAVQLKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo