SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g06960

Feature Type:gene_model
Chromosome:Gm07
Start:5613291
stop:5623529
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g06960
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G01470AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein | chr1:172295-172826 REVERSE LENGTH=151 SoyBaseE_val: 3.00E-13ISS
GO:0009269GO-bp Annotation by Michelle Graham. GO Biological Process: response to desiccation SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T430UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T430_SOYBN SoyBaseE_val: 5.00E-18ISS
UniRef100_P46519UniRef Annotation by Michelle Graham. Most informative UniRef hit: Desiccation protectant protein Lea14 homolog n=2 Tax=Glycine max RepID=LEA14_SOYBN SoyBaseE_val: 5.00E-18ISS

Expression Patterns of Glyma07g06960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g06960 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g064700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g06960
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g06960
>Glyma07g06960.1   sequence type=CDS   gene model=Glyma07g06960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCTTGGCAAAGGACATTGACTATCAATTGGATCTTGGTCTGGTTATTGACGTTCCTGTCATTGGCAACTTCACCATTCCTCTCTCTCAGAAGGGAGAGGTCAAACTACCAACCCTCTCTAACATGTTCGCCTAA
Predicted protein sequences of Glyma07g06960
>Glyma07g06960.1   sequence type=predicted peptide   gene model=Glyma07g06960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLAKDIDYQLDLGLVIDVPVIGNFTIPLSQKGEVKLPTLSNMFA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo