SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma07g06320

Feature Type:gene_model
Chromosome:Gm07
Start:5052597
stop:5055648
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23810AT Annotation by Michelle Graham. TAIR10: WRKY family transcription factor | chr4:12392666-12393739 REVERSE LENGTH=324 SoyBaseE_val: 4.00E-45ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0010193GO-bp Annotation by Michelle Graham. GO Biological Process: response to ozone SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_B0LUS6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Glycine max RepID=B0LUS6_SOYBN SoyBaseE_val: 9.00E-178ISS
UniRef100_I1KHX3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KHX3_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
WRKY55 WRKY Transcription Factor

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g02960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g057400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g06320.1   sequence type=CDS   gene model=Glyma07g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGAACTTTAAGTGTGAACAAGTTGGTCTCATTGATGAGCTAATGCAAGGGAAGGAGCTAGCAAAGCAGCTCTGTGACCATCTTCTAGTCTCATCATCATCATCATCATCTTCTCATGAAACAAATGAAGTCCTAATTGAGAAAATACTTTCCACCTATGAGAAAGCACTTGCCATGCTGAATTGCAAGGCTGATGTAGGAGAAAGTAAGGCCAAGAATGGCAGCATGATGGATTCCCATTGTCCTCTCACAAATGGTAGCCCCAAAAGTGAGGTCTTGGAGCCTGAGGTTAAGAACAAAAATGTCTTTAAGAAAAGAAAGACCATGTCAAAGTTGACAGAACAAGTGAAGGTGCGCTTGGGAACAGCACATGAAGGATCCCTGGATGATGGCTATAGCTGGAGAAAATATGGACAGAAGGACATTCTTGGAGCTAAGTTTCCAAGAGGATATTACAGATGCACGTATAGAAATGTACAAGGATGTCTGGCCACAAAGCAGGTGCAGAAGTCAGATGAAGACCCAATGATATGTGAGATAACCTACAAAGGAAGGCACACATGCAGCCAAGCAGGTCACTTAAACAAGACAGTGGCACCCCCATCAAAGAGAAAGGTGAATTTTTTGGGAGCAAATAAGCACCAAACCCATCAAATTAAGAATCAAATACAGCAAGAGAAAATAGAACAACCACCAGAGACATTTTTCACTTTTGGATCCTCAGGCCTTGAAGTTAAAATAGAGGACATGGACCACAAGGAGGACATGTTCCCATCATTTTGCTTTTCTTCTCCATTAAAAGAAGGGTCAGAAAATGGGGACAACAACAGCCTTTTCTCATATACCATGATGGAGAACAACTTAATGGAAAACTTCTCTCCTACATTCATATCTCCAACAAGTTCAGATATAGAATCAAACATTTTCTACCACTGGGGGAGCACTGGAATAGGCCAAAGTGTGCAAAGCTCAGAGTCTGATATCACTGATATAGTTTCAGCACCAACTTCAGTCACCAATTCTCCAATAATGGACCTTGATTTCTTCGATAAGATCGATTTCGACACAGATTTCCCTTTGATCCCCTCGGAACTTTGCACTTGA

>Glyma07g06320.1   sequence type=predicted peptide   gene model=Glyma07g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEENFKCEQVGLIDELMQGKELAKQLCDHLLVSSSSSSSSHETNEVLIEKILSTYEKALAMLNCKADVGESKAKNGSMMDSHCPLTNGSPKSEVLEPEVKNKNVFKKRKTMSKLTEQVKVRLGTAHEGSLDDGYSWRKYGQKDILGAKFPRGYYRCTYRNVQGCLATKQVQKSDEDPMICEITYKGRHTCSQAGHLNKTVAPPSKRKVNFLGANKHQTHQIKNQIQQEKIEQPPETFFTFGSSGLEVKIEDMDHKEDMFPSFCFSSPLKEGSENGDNNSLFSYTMMENNLMENFSPTFISPTSSDIESNIFYHWGSTGIGQSVQSSESDITDIVSAPTSVTNSPIMDLDFFDKIDFDTDFPLIPSELCT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo