Glyma07g06320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g06320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g06320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g06320

Feature Type:	gene_model
Chromosome:	Gm07
Start:	5052597
stop:	5055648
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g06320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23810	AT	Annotation by Michelle Graham. TAIR10: WRKY family transcription factor \| chr4:12392666-12393739 REVERSE LENGTH=324	SoyBase	E_val: 4.00E-45	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0009595	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0009816	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0010193	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ozone	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0031347	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0043900	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF03106	PFAM	WRKY DNA -binding domain	JGI		ISS
UniRef100_B0LUS6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Glycine max RepID=B0LUS6_SOYBN	SoyBase	E_val: 9.00E-178	ISS
UniRef100_I1KHX3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KHX3_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma07g06320

Locus	Gene Symbol	Protein Name
	WRKY55	WRKY Transcription Factor

Expression Patterns of Glyma07g06320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g06320 not represented in the dataset	Glyma07g06320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g06320

Paralog	Evidence	Comments
Glyma16g02960	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g06320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g057400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g06320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g06320

Limit To All Plant Sequences

>Glyma07g06320.1   sequence type=CDS   gene model=Glyma07g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGAACTTTAAGTGTGAACAAGTTGGTCTCATTGATGAGCTAATGCAAGGGAAGGAGCTAGCAAAGCAGCTCTGTGACCATCTTCTAGTCTCATCATCATCATCATCATCTTCTCATGAAACAAATGAAGTCCTAATTGAGAAAATACTTTCCACCTATGAGAAAGCACTTGCCATGCTGAATTGCAAGGCTGATGTAGGAGAAAGTAAGGCCAAGAATGGCAGCATGATGGATTCCCATTGTCCTCTCACAAATGGTAGCCCCAAAAGTGAGGTCTTGGAGCCTGAGGTTAAGAACAAAAATGTCTTTAAGAAAAGAAAGACCATGTCAAAGTTGACAGAACAAGTGAAGGTGCGCTTGGGAACAGCACATGAAGGATCCCTGGATGATGGCTATAGCTGGAGAAAATATGGACAGAAGGACATTCTTGGAGCTAAGTTTCCAAGAGGATATTACAGATGCACGTATAGAAATGTACAAGGATGTCTGGCCACAAAGCAGGTGCAGAAGTCAGATGAAGACCCAATGATATGTGAGATAACCTACAAAGGAAGGCACACATGCAGCCAAGCAGGTCACTTAAACAAGACAGTGGCACCCCCATCAAAGAGAAAGGTGAATTTTTTGGGAGCAAATAAGCACCAAACCCATCAAATTAAGAATCAAATACAGCAAGAGAAAATAGAACAACCACCAGAGACATTTTTCACTTTTGGATCCTCAGGCCTTGAAGTTAAAATAGAGGACATGGACCACAAGGAGGACATGTTCCCATCATTTTGCTTTTCTTCTCCATTAAAAGAAGGGTCAGAAAATGGGGACAACAACAGCCTTTTCTCATATACCATGATGGAGAACAACTTAATGGAAAACTTCTCTCCTACATTCATATCTCCAACAAGTTCAGATATAGAATCAAACATTTTCTACCACTGGGGGAGCACTGGAATAGGCCAAAGTGTGCAAAGCTCAGAGTCTGATATCACTGATATAGTTTCAGCACCAACTTCAGTCACCAATTCTCCAATAATGGACCTTGATTTCTTCGATAAGATCGATTTCGACACAGATTTCCCTTTGATCCCCTCGGAACTTTGCACTTGA

Predicted protein sequences of Glyma07g06320

Limit To All Plant Sequences

>Glyma07g06320.1   sequence type=predicted peptide   gene model=Glyma07g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEENFKCEQVGLIDELMQGKELAKQLCDHLLVSSSSSSSSHETNEVLIEKILSTYEKALAMLNCKADVGESKAKNGSMMDSHCPLTNGSPKSEVLEPEVKNKNVFKKRKTMSKLTEQVKVRLGTAHEGSLDDGYSWRKYGQKDILGAKFPRGYYRCTYRNVQGCLATKQVQKSDEDPMICEITYKGRHTCSQAGHLNKTVAPPSKRKVNFLGANKHQTHQIKNQIQQEKIEQPPETFFTFGSSGLEVKIEDMDHKEDMFPSFCFSSPLKEGSENGDNNSLFSYTMMENNLMENFSPTFISPTSSDIESNIFYHWGSTGIGQSVQSSESDITDIVSAPTSVTNSPIMDLDFFDKIDFDTDFPLIPSELCT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain