Glyma07g05260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g05260

Feature Type:	gene_model
Chromosome:	Gm07
Start:	3911299
stop:	3912261
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g05260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G53708	AT	Annotation by Michelle Graham. TAIR10: ROTUNDIFOLIA like 9 \| chr1:20052530-20053032 FORWARD LENGTH=109	SoyBase	E_val: 3.00E-19	ISS
PF08137	PFAM	DVL family	JGI		ISS
UniRef100_F4HTB2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ROTUNDIFOLIA like 9 protein n=1 Tax=Arabidopsis thaliana RepID=F4HTB2_ARATH	SoyBase	E_val: 1.00E-16	ISS
UniRef100_I1KHK6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KHK6_SOYBN	SoyBase	E_val: 1.00E-35	ISS

Expression Patterns of Glyma07g05260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g05260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g047000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g05260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g05260

Limit To All Plant Sequences

>Glyma07g05260.1   sequence type=CDS   gene model=Glyma07g05260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGTTTCTAAACTACAACAAGTGCAAGCAAGGAACTAAGGTTCCTGCAAAGAGAAAGGGATATGGGATTAGCAGCAAGTGTGCTTCTTTGGTGAAGGAGCAACGTGCTCGTCTCTATATCCTACGTCGATGTGCCACCATGCTACTTTGTTGGTATATTCAAGGAGATGATTGA

Predicted protein sequences of Glyma07g05260

Limit To All Plant Sequences

>Glyma07g05260.1   sequence type=predicted peptide   gene model=Glyma07g05260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEFLNYNKCKQGTKVPAKRKGYGISSKCASLVKEQRARLYILRRCATMLLCWYIQGDD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain