SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g04860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g04860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g04860

Feature Type:gene_model
Chromosome:Gm07
Start:3586372
stop:3587422
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g04860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G54050AT Annotation by Michelle Graham. TAIR10: HSP20-like chaperones superfamily protein | chr1:20179558-20180122 REVERSE LENGTH=155 SoyBaseE_val: 2.00E-53ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG0710 KOG Molecular chaperone (small heat-shock protein Hsp26/Hsp42) JGI ISS
PTHR11527Panther SMALL HEAT-SHOCK PROTEIN (HSP20) FAMILY JGI ISS
PF00011PFAM Hsp20/alpha crystallin family JGI ISS
UniRef100_G7L932UniRef Annotation by Michelle Graham. Most informative UniRef hit: 17.4 kDa class III heat shock protein n=1 Tax=Medicago truncatula RepID=G7L932_MEDTR SoyBaseE_val: 4.00E-72ISS
UniRef100_UPI0001D62DF2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001D62DF2 related cluster n=1 Tax=unknown RepID=UPI0001D62DF2 SoyBaseE_val: 7.00E-116ISS

Expression Patterns of Glyma07g04860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g04860 not represented in the dataset
Glyma07g04860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g04860
ParalogEvidenceComments
Glyma16g01440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g04860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g043600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g04860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g04860
>Glyma07g04860.1   sequence type=CDS   gene model=Glyma07g04860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAAGAGTTGGTGGTGATGTTTTGAACGTGGATTTGGCTGCTGCAGTGAACAACCTCTTCAATCTTCCTGAAACTATGGAGAAGTTCATGTTTCCTTCTTCTCGTGCTCATGATCACCACCATGAAACCAGAGGGGTCTCTAGCATCATTCCAGTGGACATTTTGGACACTCCCAAGGAGTATACATTCTTTATGGATGTTCCTGGTCTCTCCAAGTCTGAAATTCAGGTGACGGTTGAAGATGAGAACACACTTGTTATAAGAAGCAATGGGAAGAGGAAGCGTCAAGATGGAGAGGATGAAGGGTGCAAGTATCTTAGGTTGGAGAGGAGAGGGCCTCAGAATTTGCAGAGGAAGTTTCGTTTGCCTGAGAATGCTAATGTGTCAGCCATTACAGCTAAATGCGAAAATGGGGTTCTCACTGTGGTTGTTGAGAAGCATCCTCCTCCCCAAAAATCAAAAACTGTTGAAGTTGCCATTGCTTGA
Predicted protein sequences of Glyma07g04860
>Glyma07g04860.1   sequence type=predicted peptide   gene model=Glyma07g04860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRRVGGDVLNVDLAAAVNNLFNLPETMEKFMFPSSRAHDHHHETRGVSSIIPVDILDTPKEYTFFMDVPGLSKSEIQVTVEDENTLVIRSNGKRKRQDGEDEGCKYLRLERRGPQNLQRKFRLPENANVSAITAKCENGVLTVVVEKHPPPQKSKTVEVAIA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo