SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g04740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g04740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g04740

Feature Type:gene_model
Chromosome:Gm07
Start:3491928
stop:3496055
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11890AT Annotation by Michelle Graham. TAIR10: Synaptobrevin family protein | chr1:4011509-4012835 FORWARD LENGTH=218 SoyBaseE_val: 6.00E-150ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
KOG0862 KOG Synaptobrevin/VAMP-like protein SEC22 JGI ISS
PTHR21136Panther SNARE PROTEINS JGI ISS
PTHR21136:SF4Panther SNARE PROTEIN SEC22 JGI ISS
PF00957PFAM Synaptobrevin JGI ISS
UniRef100_C6TGR3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TGR3_SOYBN SoyBaseE_val: 8.00E-162ISS
UniRef100_Q94AU2UniRef Annotation by Michelle Graham. Most informative UniRef hit: 25.3 kDa vesicle transport protein n=1 Tax=Arabidopsis thaliana RepID=SEC22_ARATH SoyBaseE_val: 3.00E-147ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g04740 not represented in the dataset

Glyma07g04740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g01330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g042400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g04740.1   sequence type=CDS   gene model=Glyma07g04740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGTTGACTATGATTGCCCGTGTTACTGATGGTCTTCCGCTAGCTGAAGGACTGGATGATGGTCGTGATCTTAAAGATGCAGAATTTTACAAACAACAAGTCAAGGCTTTGTTTAAGAATCTCTCAAGAGGACATTATGAAGCATCAAGGATGTCAGTTGAAACTGGCCCTTATGTTTTTCATTATATTATAGAAGGACGTGTCTGTTACTTGACAATGTGTGATCGTGCATACCCTAAGAAACTAGCCTTTCAATATCTTGAAGAGCTGAGGAATGAGTTTGAGCGTGTTAATGGGTCTCAAATTGAAACTGCTGCTAGACCTTATGCCTTCATTAAGTTTGATACATTTATGCAGAAGACAAAGAAACTTTACCAGGATACACATACTCAGCGCAATATTGCAAAATTGAATGATGAACTCTATGAAGTTCACCAGATAATGACTCGGAATGTGCAGGAAGTTCTTGGTGTTGGTGAACAGTTGGACCAGGTCAGCCAAATGTCCAGTCGCTTATCATCAGAATCTCGCATATATGCTGATAAGGCTAGAGATTTAAATCGGCAGGCTTTGATTCGGAAGTGGGCCCCTGTTGCTATTGTTTTTGGAGTTGTCTTCGTACTTTTCTGGATCAAAAATAAACTATGGTGA

>Glyma07g04740.1   sequence type=predicted peptide   gene model=Glyma07g04740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKLTMIARVTDGLPLAEGLDDGRDLKDAEFYKQQVKALFKNLSRGHYEASRMSVETGPYVFHYIIEGRVCYLTMCDRAYPKKLAFQYLEELRNEFERVNGSQIETAARPYAFIKFDTFMQKTKKLYQDTHTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEQLDQVSQMSSRLSSESRIYADKARDLNRQALIRKWAPVAIVFGVVFVLFWIKNKLW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo