SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g04400

Feature Type:gene_model
Chromosome:Gm07
Start:3202414
stop:3203532
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g04400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20630AT Annotation by Michelle Graham. TAIR10: germin 3 | chr5:6975315-6975950 REVERSE LENGTH=211 SoyBaseE_val: 8.00E-78ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0031012GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0030145GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese ion binding SoyBaseN/AISS
GO:0045735GO-mf Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity SoyBaseN/AISS
PF00190PFAM Cupin JGI ISS
UniRef100_C7S8C3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 9 n=1 Tax=Glycine max RepID=C7S8C3_SOYBN SoyBaseE_val: 9.00E-147ISS
UniRef100_C7S8C3UniRef Annotation by Michelle Graham. Best UniRef hit: Germin-like protein 9 n=1 Tax=Glycine max RepID=C7S8C3_SOYBN SoyBaseE_val: 9.00E-147ISS

Expression Patterns of Glyma07g04400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g04400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g039100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g04400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g04400
>Glyma07g04400.1   sequence type=CDS   gene model=Glyma07g04400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATGATTCACTTTCTTTTCCTCTTTGCTCTTGTCTCGTTCACTTCCCATGCTTCTGTCAATGATTTCTGTGTAGCAGACCTAAAAGGTCCAGATAGCCCTTCAGGCTATCAGTGCAAGCCACCTAACACAGTCACAGTGGATGACTTTGTGTTCTCTGGCTTTGTAGCTGGAAACACCACAAACACTTTCAATGCTGCATTAACCTCCGCATTTGTTACTGATTTTCCAGGTGTGAATGGTCTTGGTGTATCTGCGGCACGGTTAGACATAGCCAAAGGTGGATCAATCCCAATGCACACACACCCTGCTGCCACTGAACTTCTAATAATGGTGGAAGGTCAAATCACTGCTGGTTTTATGACCCCAACTGCACTTTATACCAAGACACTGAAACCTGGAGATATTATGGTTTTTCCACAAGGACAGTTGCATTTTCAGGTTAATTCTGGAAACGGAAAAGCCACTGCTTTTCTGGCATTCAGTAGTGCAAACCCTGGAGCACAACTACTTGACCTTCTGTTATTTGGCAACACCTTGCCTTCTGACTTGGTTGCACAAACTACCTTCCTTGATGTTGCACAAGTCAAGAAACTTAAGGCTCGTTTCGGTGGCAGAGGCTAG
Predicted protein sequences of Glyma07g04400
>Glyma07g04400.1   sequence type=predicted peptide   gene model=Glyma07g04400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMIHFLFLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVAGNTTNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQITAGFMTPTALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLLFGNTLPSDLVAQTTFLDVAQVKKLKARFGGRG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo