Glyma07g03831 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g03831): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g03831): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g03831

Feature Type:	gene_model
Chromosome:	Gm07
Start:	2657784
stop:	2663751
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g03831

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G80370	AT	Annotation by Michelle Graham. TAIR10: Cyclin A2;4 \| chr1:30214694-30216861 FORWARD LENGTH=461	SoyBase	E_val: 3.00E-166	ISS
GO:0000079	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cyclin-dependent protein kinase activity	SoyBase	N/A	ISS
GO:0006275	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0010374	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex development	SoyBase	N/A	ISS
GO:0010389	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle	SoyBase	N/A	ISS
GO:0042023	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0043248	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome assembly	SoyBase	N/A	ISS
GO:0051510	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth	SoyBase	N/A	ISS
GO:0051726	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016538	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase regulator activity	SoyBase	N/A	ISS
GO:0019901	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase binding	SoyBase	N/A	ISS
KOG0654	KOG	G2/Mitotic-specific cyclin A	JGI		ISS
PTHR10177	Panther	CYCLINS	JGI		ISS
PTHR10177:SF49	Panther	G2/MITOTIC-SPECIFIC CYCLIN	JGI		ISS
PF00134	PFAM	Cyclin, N-terminal domain	JGI		ISS
PF02984	PFAM	Cyclin, C-terminal domain	JGI		ISS
UniRef100_G7IME2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cyclin A2 n=1 Tax=Medicago truncatula RepID=G7IME2_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1KV98	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV98_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma07g03831

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g03831 not represented in the dataset	Glyma07g03831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g03831

Paralog	Evidence	Comments
Glyma08g22200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g03831 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g034100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g03831

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g03831

Limit To All Plant Sequences

>Glyma07g03831.1   sequence type=CDS   gene model=Glyma07g03831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAAGAAAACAGTGTTATGCTGAAAGCTGGGGAGCTCCCTGGTCGATTGACTCGTGCTCGAGCTGCTGCTGCTCTTCGTGCATATGGACAGCTACCCCCTTTGAAAGAGAGAGCACAGCAAAATCAGAATCAGTTATCCAGAGTCAATTCAAAAAGAGCAGTTTCTGATAATACATGTGTTCAGCGTAAAAGGAAGGCTGTTCTTCAGGAAGTTACTAATGTTTGCTGTGAAAATGCCTACAAGGCTTGTCTCAACTCAACTAATATTCAGGCTAGGAAAAGCAAGCTGGCTAAGGCTGGTCAAATTAATGTGTCCAAAGTGGCTCCTTCTGTTACTGTGGAGCCACGACAATTTCAAGTTGACTCCAAAGCAAAGGAAACAGCATTGCAATCAGAAGATACTATGTGCTCAATTAATTTGGAAAACAATGAACTTCTACAACTGAATGCCAATGATTGTAGCAAGGACTTTAGATTGCCTGAAAGTCAGATGTCTGGAATATCTGCTCACCCTTTGATTTCTCAGAAGAAAGACACGAAAGATAACCTTCCAAAACTTTTGACTGCATTGAAGGATTCAGACATCACTAATATAGATGATGATGATCTTGAAGATCCTCAGTCGTGCAGCCTCTATGCTGCTGATATCTACGACACCATTCGCGTTGCTGAGCTTGCGAGAAGGCCTTATCCGAACTTTATGGAGACAGTGCAGCGAGATATTACTCAAAGCATGCGTGGAATACTGGTTGATTGGCTTGTAGAGGTTTCTGAGGAATACAAATTGGTTACAGACACTCTTTACCTCACTGTGTATCTCATAGATTGGTTTCTGTCCAAAAATTACATTGAAAGACAAAGACTTCAGCTACTTGGCATCACCTGCATGCTAATTGCCTCGAAGTACGAAGAAATCAATGCCCCACGTATTGAAGATTTCTGCTTCATCACAGACAATACATACACGAAAGCTGAGGTACTAAAAATGGAGAGTCAAGTGTTGAAGTCGTCTGAATATCAACTGTATACTCCCACTATACAAACTTTCCTCAGGAGGTTTCTTCGGGCAGCACAAGCTTCATACAAGGACCAAAGCCTTGAATTGGAGTGCCTGGCCAATTACCTAGCTGAACTAACACTGATGGACTATGGTTTCTTGAATTTCCTTCCCTCTATTATTGCTGCATCAGCTGTATTTCTTGCAAGGTGGACACTAGATCAGTCAAACCACCCATGGAATCCAACTCTTCAACACTATGCCTGTTACAAAGCATCGGATTTGAAAACCACAGTTCTTGCACTACAAGACCTACAGCTGAATACTGATGGCTGTTCTCTAACTGCCGTCCGCACGAAATACAGACAAGACAATTTTAAATGTGTAGCGGCCTTGTCTTCACCAAAACTGCTTGAAACTTTGTTCTGA

Predicted protein sequences of Glyma07g03831

Limit To All Plant Sequences

>Glyma07g03831.1   sequence type=predicted peptide   gene model=Glyma07g03831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKENSVMLKAGELPGRLTRARAAAALRAYGQLPPLKERAQQNQNQLSRVNSKRAVSDNTCVQRKRKAVLQEVTNVCCENAYKACLNSTNIQARKSKLAKAGQINVSKVAPSVTVEPRQFQVDSKAKETALQSEDTMCSINLENNELLQLNANDCSKDFRLPESQMSGISAHPLISQKKDTKDNLPKLLTALKDSDITNIDDDDLEDPQSCSLYAADIYDTIRVAELARRPYPNFMETVQRDITQSMRGILVDWLVEVSEEYKLVTDTLYLTVYLIDWFLSKNYIERQRLQLLGITCMLIASKYEEINAPRIEDFCFITDNTYTKAEVLKMESQVLKSSEYQLYTPTIQTFLRRFLRAAQASYKDQSLELECLANYLAELTLMDYGFLNFLPSIIAASAVFLARWTLDQSNHPWNPTLQHYACYKASDLKTTVLALQDLQLNTDGCSLTAVRTKYRQDNFKCVAALSSPKLLETLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain