SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g03570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g03570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g03570

Feature Type:gene_model
Chromosome:Gm07
Start:2494301
stop:2496395
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15390AT Annotation by Michelle Graham. TAIR10: peptide deformylase 1A | chr1:5294653-5295625 FORWARD LENGTH=269 SoyBaseE_val: 4.00E-39ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0043686GO-bp Annotation by Michelle Graham. GO Biological Process: co-translational protein modification SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0042586GO-mf Annotation by Michelle Graham. GO Molecular Function: peptide deformylase activity SoyBaseN/AISS
PTHR10458Panther POLYPEPTIDE DEFORMYLASE JGI ISS
PF01327PFAM Polypeptide deformylase JGI ISS
UniRef100_E6NUC7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptide deformylase n=1 Tax=Jatropha curcas RepID=E6NUC7_9ROSI SoyBaseE_val: 2.00E-46ISS
UniRef100_I1KVC5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KVC5_SOYBN SoyBaseE_val: 5.00E-48ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g03570 not represented in the dataset

Glyma07g03570 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g22520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g03570.2   sequence type=CDS   gene model=Glyma07g03570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGATCCTGAATCCCAAGCTAGAGAAGAAGGGCAAGAAGAGGACTGCTCTATTTTTTGAAGGGTGCTTGAGCGTTGACGGGTTTAGAGCAGTGGTGGAGCGACACCTTGACATTGAAGTTACAGGTTTGGATCGTTATGGTGAGCCAATCAAAATAAATGCTTCTGGCTGGCAGGCTCGGATTTTACAACATGAGTGTGACCACTTGGATGGAACTCTATATGTTGATAAGATGGTACCCAAAACTTTTTGA

>Glyma07g03570.2   sequence type=predicted peptide   gene model=Glyma07g03570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVILNPKLEKKGKKRTALFFEGCLSVDGFRAVVERHLDIEVTGLDRYGEPIKINASGWQARILQHECDHLDGTLYVDKMVPKTF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo