SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g03450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g03450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g03450

Feature Type:gene_model
Chromosome:Gm07
Start:2422428
stop:2423510
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g03450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52560AT Annotation by Michelle Graham. TAIR10: HSP20-like chaperones superfamily protein | chr1:19574783-19575766 REVERSE LENGTH=232 SoyBaseE_val: 3.00E-45ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR11527Panther SMALL HEAT-SHOCK PROTEIN (HSP20) FAMILY JGI ISS
PTHR11527:SF16Panther SMALL HEAT-SHOCK PROTEIN JGI ISS
PF00011PFAM Hsp20/alpha crystallin family JGI ISS
UniRef100_I1KH16UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KH16_SOYBN SoyBaseE_val: 1.00E-94ISS
UniRef100_Q9SSQ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26.5 kDa heat shock protein, mitochondrial n=1 Tax=Arabidopsis thaliana RepID=HS26M_ARATH SoyBaseE_val: 1.00E-42ISS

Expression Patterns of Glyma07g03450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g03450 not represented in the dataset
Glyma07g03450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g03450
ParalogEvidenceComments
Glyma08g22630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g03450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma07g03450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g03450
>Glyma07g03450.2   sequence type=CDS   gene model=Glyma07g03450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTCAACATCATATGGCTTTGAAGAACTTGCAGAAAAGGGTGTGTGCTTCCTCTTCCTTGATTGGCAATGTGCAGAAGCAGAGGTGGAACAATGAATTGGTCAAAAGGTTTGGTAGTGCACTGAAGTTGCTGTCACCGAAGGGAAAAAAATTCTTTCCTTGGGGGCTTGGGAGTGCACTGATGCAGGCAAGTGAGAACATCAACAGGTTGTTTGAGAACATGAATCTGAGACCTTGGTCTCTGAGTGGAGAGGACGTGAAGATCACTATTGATGATGGGGTGCTGACAATAAAGGGAGAGCACAAGGAAGAGAAAGATGATGATGAGCATTGGTCATCAACAAGTAGCTATGGATACTATAACACAAGCCTGCTTTTGCCTGATGATGCCAAGGCTGATGACATTAAGGCAGAGTTGAAAGATGGTGTCCTAACTGTAACCATTCCTAGGACTGAGAAGCCCAAAAAGGATGTCAAACAAGTCACAGTAGAATGA
Predicted protein sequences of Glyma07g03450
>Glyma07g03450.2   sequence type=predicted peptide   gene model=Glyma07g03450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQHHMALKNLQKRVCASSSLIGNVQKQRWNNELVKRFGSALKLLSPKGKKFFPWGLGSALMQASENINRLFENMNLRPWSLSGEDVKITIDDGVLTIKGEHKEEKDDDEHWSSTSSYGYYNTSLLLPDDAKADDIKAELKDGVLTVTIPRTEKPKKDVKQVTVE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo