SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g03390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g03390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g03390

Feature Type:gene_model
Chromosome:Gm07
Start:2379437
stop:2381541
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g03390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80100AT Annotation by Michelle Graham. TAIR10: histidine phosphotransfer protein 6 | chr1:30133818-30134652 FORWARD LENGTH=154 SoyBaseE_val: 2.00E-69ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG4747 KOG Two-component phosphorelay intermediate involved in MAP kinase cascade regulation JGI ISS
PF01627PFAM Hpt domain JGI ISS
UniRef100_G7II71UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histidine phosphotransfer protein n=1 Tax=Medicago truncatula RepID=G7II71_MEDTR SoyBaseE_val: 6.00E-91ISS
UniRef100_I1KH10UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KH10_SOYBN SoyBaseE_val: 3.00E-110ISS

Proteins Associated with Glyma07g03390
LocusGene SymbolProtein Name
PHP1 Ubiquitous, Phosphotransfer Protein

Expression Patterns of Glyma07g03390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g03390 not represented in the dataset
Glyma07g03390 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g03390
ParalogEvidenceComments
Glyma08g22721 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g03390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g030100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g03390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g03390
>Glyma07g03390.1   sequence type=CDS   gene model=Glyma07g03390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGGTTTGGGTGCGGACCTCTTGTGGGCCGACATGAACCGTCTCCTCGCCTTTCTCTTCCACCAGGGAGTGTTGGATGAGCAATTCTTGCAGCTTCAGCAGCTGCAGGATGAGACCTCCCCAAACTTCGTCTCCGAGGTTGTCAACATTTATTTCCACGAATCCGAAAAGCTTCTCAGAAATCTCAGAGCTTTGCTGATGGAGAAGGAGTTTTCTGACTATAAGAAAATGGGGATACATTTGAATCAGTTCGTGGGTAGCAGCTCAAGTATTGGCGCCAAGAGAGTTAGAAATGTTTGCGTTGCCTTTCGTGCAGCTACTGAACAGAATAACCGTGCTGGTTGCTTGCGAGCGTTGGAGATGCTGGAGCATGAATATTGCTATCTCAAGAACAAATTGCACGAATTGTTCCAAATTGAACAGCAACGTGCTTTGGCAGCAGGAGTAAGGTACCCGGTGCAGAATTAA
Predicted protein sequences of Glyma07g03390
>Glyma07g03390.1   sequence type=predicted peptide   gene model=Glyma07g03390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGLGADLLWADMNRLLAFLFHQGVLDEQFLQLQQLQDETSPNFVSEVVNIYFHESEKLLRNLRALLMEKEFSDYKKMGIHLNQFVGSSSSIGAKRVRNVCVAFRAATEQNNRAGCLRALEMLEHEYCYLKNKLHELFQIEQQRALAAGVRYPVQN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo