Report for Sequence Feature Glyma07g03041
Feature Type: gene_model
Chromosome: Gm07
Start: 2099664
stop: 2100299
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g03041
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G80580 AT
Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr1:30293558-30294328 FORWARD LENGTH=256
SoyBase E_val: 2.00E-27 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009873 GO-bp
Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PF00847 PFAM
AP2 domain
JGI ISS
UniRef100_G7JFP6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7JFP6_MEDTR
SoyBase E_val: 1.00E-42 ISS
UniRef100_I1KGW9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KGW9_SOYBN
SoyBase E_val: 3.00E-87 ISS
Expression Patterns of Glyma07g03041
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g03041
Paralog Evidence Comments
Glyma08g23074 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g03041 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g027000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g03041
Coding sequences of Glyma07g03041
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g03041.1 sequence type=CDS gene model=Glyma07g03041 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAACGGCGAACTCTTCTTACACGCGCCCACCACCACCACCACTAACTTTTTGCTTCCAAAAAAATCCCAAACGGCGTCGTCGGAGACACTGGACCCATCACAGAAGCTACGACGCTACGAAACGGCGCTGGAAGGAATCGCCGCGGTCGTGGGAGAACACGTCCTCTTCGGAACCACGTTGTCGCATGTTTCTGAGACTCCGAAGAAGACAAATGGCGTGTCGTCATCGTTGAGCAAGAGCTACAGAGGAGTAAGGAAGCGACCGTGGGGGAGGTGGTCGGCGGAGATACGCGACCGCATCGGGCGGTGCCGCCACTGGCTGGGGACTTTCGACACGGCGGAGGAGGCGGCGCGTGCGTACGACGCGGCGGCGAGGCGCATGAGAGGCGCGAAGGCGAGGACCAACTTCAAGATACCCTCGGTGTTGCCACTTTCTCCGGAAGGGGTTCATGGTAGTGCCGTGAAGCCGAAAACCGCGCGAAGCAACGCTAGGAAGTGTTCTTCCGTGGAACAATTGTTCAGTGGGGTGCCTCAACTTCGAAAAGATGATGGTATCGGCGAGAATGGGAATGTGGAGGTCGATTTGAAGCTGGGTGTGAACTTTGGTGTTACGAGCTCTAGAATGGTGCTTTAG
Predicted protein sequences of Glyma07g03041
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g03041.1 sequence type=predicted peptide gene model=Glyma07g03041 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNGELFLHAPTTTTTNFLLPKKSQTASSETLDPSQKLRRYETALEGIAAVVGEHVLFGTTLSHVSETPKKTNGVSSSLSKSYRGVRKRPWGRWSAEIRDRIGRCRHWLGTFDTAEEAARAYDAAARRMRGAKARTNFKIPSVLPLSPEGVHGSAVKPKTARSNARKCSSVEQLFSGVPQLRKDDGIGENGNVEVDLKLGVNFGVTSSRMVL*