SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma07g03041

Feature Type:gene_model
Chromosome:Gm07
Start:2099664
stop:2100299
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80580AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr1:30293558-30294328 FORWARD LENGTH=256 SoyBaseE_val: 2.00E-27ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7JFP6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7JFP6_MEDTR SoyBaseE_val: 1.00E-42ISS
UniRef100_I1KGW9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KGW9_SOYBN SoyBaseE_val: 3.00E-87ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g03041 not represented in the dataset

Glyma07g03041 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g23074 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g027000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g03041.1   sequence type=CDS   gene model=Glyma07g03041   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACGGCGAACTCTTCTTACACGCGCCCACCACCACCACCACTAACTTTTTGCTTCCAAAAAAATCCCAAACGGCGTCGTCGGAGACACTGGACCCATCACAGAAGCTACGACGCTACGAAACGGCGCTGGAAGGAATCGCCGCGGTCGTGGGAGAACACGTCCTCTTCGGAACCACGTTGTCGCATGTTTCTGAGACTCCGAAGAAGACAAATGGCGTGTCGTCATCGTTGAGCAAGAGCTACAGAGGAGTAAGGAAGCGACCGTGGGGGAGGTGGTCGGCGGAGATACGCGACCGCATCGGGCGGTGCCGCCACTGGCTGGGGACTTTCGACACGGCGGAGGAGGCGGCGCGTGCGTACGACGCGGCGGCGAGGCGCATGAGAGGCGCGAAGGCGAGGACCAACTTCAAGATACCCTCGGTGTTGCCACTTTCTCCGGAAGGGGTTCATGGTAGTGCCGTGAAGCCGAAAACCGCGCGAAGCAACGCTAGGAAGTGTTCTTCCGTGGAACAATTGTTCAGTGGGGTGCCTCAACTTCGAAAAGATGATGGTATCGGCGAGAATGGGAATGTGGAGGTCGATTTGAAGCTGGGTGTGAACTTTGGTGTTACGAGCTCTAGAATGGTGCTTTAG

>Glyma07g03041.1   sequence type=predicted peptide   gene model=Glyma07g03041   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNGELFLHAPTTTTTNFLLPKKSQTASSETLDPSQKLRRYETALEGIAAVVGEHVLFGTTLSHVSETPKKTNGVSSSLSKSYRGVRKRPWGRWSAEIRDRIGRCRHWLGTFDTAEEAARAYDAAARRMRGAKARTNFKIPSVLPLSPEGVHGSAVKPKTARSNARKCSSVEQLFSGVPQLRKDDGIGENGNVEVDLKLGVNFGVTSSRMVL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo