|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G15880 | AT | Annotation by Michelle Graham. TAIR10: golgi snare 11 | chr1:5458718-5460089 REVERSE LENGTH=223 | SoyBase | E_val: 1.00E-40 | ISS |
| GO:0006869 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid transport | SoyBase | N/A | ISS |
| GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0006891 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0010351 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lithium ion transport | SoyBase | N/A | ISS |
| GO:0016558 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix | SoyBase | N/A | ISS |
| GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0000149 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: SNARE binding | SoyBase | N/A | ISS |
| PTHR21094 | Panther | GOS-28 SNARE- RELATED | JGI | ISS | |
| PF12352 | PFAM | Snare region anchored in the vesicle membrane C-terminus | JGI | ISS | |
| UniRef100_I1KVK0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Golgi SNAP receptor complex member 1 n=3 Tax=Glycine max RepID=I1KVK0_SOYBN | SoyBase | E_val: 9.00E-43 | ISS |
| UniRef100_I1KVK0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Golgi SNAP receptor complex member 1 n=3 Tax=Glycine max RepID=I1KVK0_SOYBN | SoyBase | E_val: 9.00E-43 | ISS |
|
Glyma07g02861 not represented in the dataset |
Glyma07g02861 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g025100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g02861.1 sequence type=CDS gene model=Glyma07g02861 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACAATGTAATTTCACAAGCACAAGCAACACTAGGAGCACTTGTCTTCCAACGTTCAACATTTGGCGGTATCAATTCAAAGCTCGGCAATGTGAGCAGTCGCCTCCCAACGGTAAATAACATACTTTCAGCAATAAAGAGAAAAAAGTCAATGGATACCATTAGACTTTCCCTTGTTGCAGCCGTATGCACATTTCTCATTTTCATGTACTGGCTATCCAAGTGA
>Glyma07g02861.1 sequence type=predicted peptide gene model=Glyma07g02861 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDNVISQAQATLGALVFQRSTFGGINSKLGNVSSRLPTVNNILSAIKRKKSMDTIRLSLVAAVCTFLIFMYWLSK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||