SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G80860 | AT | Annotation by Michelle Graham. TAIR10: phospholipid N-methyltransferase | chr1:30388432-30389284 REVERSE LENGTH=164 | SoyBase | E_val: 9.00E-64 | ISS |
| GO:0008654 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phospholipid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0043231 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle | SoyBase | N/A | ISS |
| GO:0000773 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phosphatidyl-N-methylethanolamine N-methyltransferase activity | SoyBase | N/A | ISS |
| GO:0080101 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phosphatidyl-N-dimethylethanolamine N-methyltransferase activity | SoyBase | N/A | ISS |
| PTHR15458 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR15458:SF7 | Panther | N-METHYLTRANSFERASE | JGI | ISS | |
| PF04191 | PFAM | Phospholipid methyltransferase | JGI | ISS | |
| UniRef100_C3VD33 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Phospholipid N-methyltransferase n=1 Tax=Glycine max RepID=C3VD33_SOYBN | SoyBase | E_val: 7.00E-76 | ISS |
| UniRef100_C3VD33 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Phospholipid N-methyltransferase n=1 Tax=Glycine max RepID=C3VD33_SOYBN | SoyBase | E_val: 7.00E-76 | ISS |
|
Glyma07g02601 not represented in the dataset |
Glyma07g02601 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma08g23410 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g022900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g02601.1 sequence type=CDS gene model=Glyma07g02601 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACAAGTGATGGGATTGCGGCGGCTGTTGGAGTTTTGTCACCGTTTCCGTTCTATTACTGCCTCTGGATTTGGCCACAGTCATGGGTGGACTTGTGTGGCAGAGCCCGAGACCCATCTAAGGTTATGGCTTACGTTGCTCATTTCTTGAAGCTCATCCTGGTTTATCAGCTACTTGGTGAGGCTGGCACATACTACGGTGTACGCTTTGGAAAAACTATTCCCTGGGTAACTGAATTCCCTTTTGGTGTCATCAAAGATCCTCAGTACGTTGGCAGCATTATGAGTCTTCTTGCATGCTTCTTGTGGGTTCCTTTTCAATACATTCTCCTTTGGGTATTAGGATATGTGTTTATGATGCATGTGGAATCAAAGGAAGATCCATCTACTCGTGCCAAACCACTCCATTGA
>Glyma07g02601.1 sequence type=predicted peptide gene model=Glyma07g02601 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTSDGIAAAVGVLSPFPFYYCLWIWPQSWVDLCGRARDPSKVMAYVAHFLKLILVYQLLGEAGTYYGVRFGKTIPWVTEFPFGVIKDPQYVGSIMSLLACFLWVPFQYILLWVLGYVFMMHVESKEDPSTRAKPLH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
