|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G36890 | AT | Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferases superfamily protein | chr4:17379631-17381627 REVERSE LENGTH=525 | SoyBase | E_val: 2.00E-13 | ISS |
| GO:0007155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell adhesion | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fruit development | SoyBase | N/A | ISS |
| GO:0010417 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucuronoxylan biosynthetic process | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0048367 | GO-bp | Annotation by Michelle Graham. GO Biological Process: shoot development | SoyBase | N/A | ISS |
| GO:0048765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005802 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0015018 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity | SoyBase | N/A | ISS |
| GO:0016757 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups | SoyBase | N/A | ISS |
| GO:0042285 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: xylosyltransferase activity | SoyBase | N/A | ISS |
| UniRef100_I1LHB1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LHB1_SOYBN | SoyBase | E_val: 1.00E-25 | ISS |
| UniRef100_Q4VZ79 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glycosyltransferase n=1 Tax=Glycine max RepID=Q4VZ79_SOYBN | SoyBase | E_val: 1.00E-25 | ISS |
|
Glyma07g02230 not represented in the dataset |
Glyma07g02230 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g019600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g02230.1 sequence type=CDS gene model=Glyma07g02230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGCTCTCGGCGTTGCAGCAGAGTTACCTCTCGCGCTGGGCGAACAACTTTAGAGGATTGGCTGAAGTTGCTGGCGGCGATTTTCTGGCTGGTAATCCAGCGTCTGCTGTCTCATTAGCTTGGTTCTCGACTTCCACTTCTCGCGCCTCGTCTTCTTCCTTTTCTCAACAAGCCTCTACATCGCGTCGTTCCGGAGGTTTAGAAATCGTAGCTCTGCATGACGTTCCTCCAACAAAGAACCGGACGGCGATGGCGAGCACCGCAAGACTCGTGGTAGTCGGGCGGCACGGTATCCGAATCCGGCCGTGGCCGCATTCGGATCTCGGGGAGGTGATGAAGGCGCACCGCATATCGAGAGAGTGCAGAAAGAGTAGGGGCGCTATTCGGAGTGAAAAACCCTAG
>Glyma07g02230.1 sequence type=predicted peptide gene model=Glyma07g02230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKLSALQQSYLSRWANNFRGLAEVAGGDFLAGNPASAVSLAWFSTSTSRASSSSFSQQASTSRRSGGLEIVALHDVPPTKNRTAMASTARLVVVGRHGIRIRPWPHSDLGEVMKAHRISRECRKSRGAIRSEKP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||