SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g01840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g01840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g01840

Feature Type:gene_model
Chromosome:Gm07
Start:1224069
stop:1226448
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16360AT Annotation by Michelle Graham. TAIR10: HPT phosphotransmitter 4 | chr3:5554351-5555518 FORWARD LENGTH=145 SoyBaseE_val: 1.00E-73ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0080036GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0009927GO-mf Annotation by Michelle Graham. GO Molecular Function: histidine phosphotransfer kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG4747 KOG Two-component phosphorelay intermediate involved in MAP kinase cascade regulation JGI ISS
PF01627PFAM Hpt domain JGI ISS
UniRef100_G7IHZ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histidine phosphotransfer protein n=1 Tax=Medicago truncatula RepID=G7IHZ9_MEDTR SoyBaseE_val: 3.00E-86ISS
UniRef100_I1KGI8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KGI8_SOYBN SoyBaseE_val: 2.00E-100ISS

LocusGene SymbolProtein Name
HP07 Shoot preferential, Phosphotransfer Protein

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g01840 not represented in the dataset

Glyma07g01840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g21510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g015600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g01840.1   sequence type=CDS   gene model=Glyma07g01840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAGAAACCAATCCCGCAGGCAGGTTGCCGCAATGAAACAGTCCCTCTTTGATCAGGGGTTCCTGGACGAACAGTTTATCCAACTGGAAGAATTGCAGGATGATGCAAATCCTAACTTTGTTGAGGAAATCGTGACTCTTCACTACCGTGATTCGTCACGGCTTATCTCAAGCATAGAGCAGGCTCTCAAAGAGAGGAACCCTCTGGATTTCAACAAGCTGGACACACTTATGCATCAGTTCAAAGGAAGCAGTTCAAGCATAGGAGCCAAAAAGGTGAAAGCAGAGTGCAATCTGTTCAGGGAATATTGCAGGACAGGAAATGCAGAAGGATGCATGAGGAGCTTCCAACAACTGAAGAGAGAATATGCTGCACTGAGAAAGAAACTTGAAGCTTATTTTCAGTTGGCTAGGCAAGCTGGACCCTAG

>Glyma07g01840.1   sequence type=predicted peptide   gene model=Glyma07g01840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRNQSRRQVAAMKQSLFDQGFLDEQFIQLEELQDDANPNFVEEIVTLHYRDSSRLISSIEQALKERNPLDFNKLDTLMHQFKGSSSSIGAKKVKAECNLFREYCRTGNAEGCMRSFQQLKREYAALRKKLEAYFQLARQAGP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo