SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g01560

Feature Type:gene_model
Chromosome:Gm07
Start:1010454
stop:1012089
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g01560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G51760AT Annotation by Michelle Graham. TAIR10: peptidase M20/M25/M40 family protein | chr1:19199562-19201424 FORWARD LENGTH=440 SoyBaseE_val: 3.00E-50ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008237GO-mf Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity SoyBaseN/AISS
GO:0010179GO-mf Annotation by Michelle Graham. GO Molecular Function: IAA-Ala conjugate hydrolase activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PF07687PFAM Peptidase dimerisation domain JGI ISS
UniRef100_Q84XG9UniRef Annotation by Michelle Graham. Most informative UniRef hit: IAA-amino acid hydrolase ILR1-like 1 n=1 Tax=Oryza sativa Indica Group RepID=ILL1_ORYSI SoyBaseE_val: 4.00E-52ISS
UniRef100_UPI0002337D93UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337D93 related cluster n=1 Tax=unknown RepID=UPI0002337D93 SoyBaseE_val: 3.00E-101ISS

Expression Patterns of Glyma07g01560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g01560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g013100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g01560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g01560
>Glyma07g01560.1   sequence type=CDS   gene model=Glyma07g01560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTACTAATGTGATTATTAGCTTACAAAACCTTGTTTCTCGCGAGGCTGATCCTCGAGTTTCAAAGCTCCAAGGAGGTGCTGCATTCAATGTTATTCCAGATTATGTCATCATTGATGGCACCTTCCGAGCTCTTTCTAGAGAAACATTGAAGCACCTTAAACAGCGCATTGAGCAGGTTATCATTGGTCAAGCTGCTGTGCAGAGGTGCAATGCAAATGTCAATTTCCATGATGAAGAGAAACCTTTATATCCTCCAACTATAAATAATGATGACTTGCACAAGTTTTTTGTTGATACTTGGCCGCTGAAGACTTTGCTTGGAATGAAGAATGCTTCATTTGAACCGGTTGCGCCATTACATTCACCCTATCTCGTAATCAATGAAGATGGACTTCCCTATGGGGCTGCACTTCATGCATCATTGGCCACTAGTTATCTTACAAATTATCAGCAGGACATAGCCAGGAGCCATTGTAGTCTTATTTCTTGCAACATTAACCTGATATGTGAAAGCATTGTTTACAGTTTTAATTGTTGCATGGTTTAG
Predicted protein sequences of Glyma07g01560
>Glyma07g01560.1   sequence type=predicted peptide   gene model=Glyma07g01560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATNVIISLQNLVSREADPRVSKLQGGAAFNVIPDYVIIDGTFRALSRETLKHLKQRIEQVIIGQAAVQRCNANVNFHDEEKPLYPPTINNDDLHKFFVDTWPLKTLLGMKNASFEPVAPLHSPYLVINEDGLPYGAALHASLATSYLTNYQQDIARSHCSLISCNINLICESIVYSFNCCMV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo