|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G21250 | AT | Annotation by Michelle Graham. TAIR10: multidrug resistance-associated protein 6 | chr3:7457668-7463261 REVERSE LENGTH=1453 | SoyBase | E_val: 5.00E-41 | ISS |
GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
GO:0000325 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole | SoyBase | N/A | ISS |
GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
GO:0042626 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances | SoyBase | N/A | ISS |
PTHR24223 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR24223:SF203 | Panther | JGI | ISS | ||
UniRef100_G8A2R9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Multidrug resistance protein ABC transporter family n=1 Tax=Medicago truncatula RepID=G8A2R9_MEDTR | SoyBase | E_val: 2.00E-45 | ISS |
UniRef100_G8A2R9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Multidrug resistance protein ABC transporter family n=1 Tax=Medicago truncatula RepID=G8A2R9_MEDTR | SoyBase | E_val: 2.00E-45 | ISS |
Glyma07g01363 not represented in the dataset |
Glyma07g01363 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.07g011400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g01363.1 sequence type=CDS gene model=Glyma07g01363 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAGGCATTGAAGATATGTGTCTACTCAATGAGGCTATTAGTGGATTACCATATCTACTGGACTCATCAGTGAGTAATGAAGGTGAAAATTGGAGCATGGGACAATGCCAATTATTTTGCCTTGGAAGGTTTCTTCTAAAAAGGAATAGAATTTTAGTTGTAGATTCCATTGATTCTGCAACAGATGCCATTTTACAAAGGGTCCTCAGGCATGAATTCTCTGAATGCACAGTTATAAATGTGGCTCACAGAGTTCCAACTGTAATAGACAGTGACATGGTCATGGTCCTGTCTTATGTTAAGCTTCTTTTTCTTTTGTACATAGCAGGACACTTAAAACTCTCCCCTATTTCCCCCAAATAG
>Glyma07g01363.1 sequence type=predicted peptide gene model=Glyma07g01363 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEGIEDMCLLNEAISGLPYLLDSSVSNEGENWSMGQCQLFCLGRFLLKRNRILVVDSIDSATDAILQRVLRHEFSECTVINVAHRVPTVIDSDMVMVLSYVKLLFLLYIAGHLKLSPISPK*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||