SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g01200

Feature Type:gene_model
Chromosome:Gm07
Start:723746
stop:725058
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g01200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17620AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr1:6062313-6063107 FORWARD LENGTH=264 SoyBaseE_val: 9.00E-51ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_A2Q440UniRef Annotation by Michelle Graham. Most informative UniRef hit: Harpin-induced 1 n=1 Tax=Medicago truncatula RepID=A2Q440_MEDTR SoyBaseE_val: 2.00E-75ISS
UniRef100_I1KGB9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KGB9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma07g01200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g01200 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g009700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g01200
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g01200
>Glyma07g01200.1   sequence type=CDS   gene model=Glyma07g01200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGATAGGGTTCACCCTTCGGCCAAAACCACCGCCAACGCCGGCCCCAAGCCGACATTCCCCGCTACGAAATCCCAGCTTTCCGGCGCCAACCGCCCCACCTACCGCCCCCAACCGCAGCACCACCGCCGCCGCCGTAGTCGCGGATGTGCCTCCACCCTCTGCTGCTGGCTCCTCCTGATCCTCCTCTTCCTCCTCCTCCTCGTCGGTGCCGCCGGCACCGTCCTCTACTTTCTCTACCGTCCCCAACGACCCACATTCTCCGTCACCTCCCTAAAACTCTCTTCCTTCAACCTCACCACTCCCTCCACCATCAACGCCAAGTTTGACCTCACTCTCTCAACAACTAACCCTAACGACAAAATCATCTTCTCCTACGACCCTACCTCCGTATCCCTTCTCTACGGCGACACCGCCGTCGCCAGCACCACCATCCCCTCCTTCCTCCACCGCCAAAGGAACACCACCGTGCTCCAGGCTTATGTTACTAGCACTGAGGAAGTGGTGGATAGTGACGCCGCGATGGAGCTGAAGAGGAGCATGAAGAGGAAGAGTCAGCTGGTGGCGCTGAAGGTGGAGCTGGAGACCAAGGTGGAGGCCCAGATGGGCGTGTTCCAGACGCCTCGAGTCGGGATCAAGGTTCTGTGCGACGGCGTCGCCGTATCTCTCCCCGACGATGAGAAACCGGCGACGGCGTCGGCTGAGAATACGGCGTGCCAGGTGGATGTGAGGTTTAAGGTCTGGAAATGGACCGTTGGATGA
Predicted protein sequences of Glyma07g01200
>Glyma07g01200.1   sequence type=predicted peptide   gene model=Glyma07g01200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTDRVHPSAKTTANAGPKPTFPATKSQLSGANRPTYRPQPQHHRRRRSRGCASTLCCWLLLILLFLLLLVGAAGTVLYFLYRPQRPTFSVTSLKLSSFNLTTPSTINAKFDLTLSTTNPNDKIIFSYDPTSVSLLYGDTAVASTTIPSFLHRQRNTTVLQAYVTSTEEVVDSDAAMELKRSMKRKSQLVALKVELETKVEAQMGVFQTPRVGIKVLCDGVAVSLPDDEKPATASAENTACQVDVRFKVWKWTVG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo