SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma07g00960

Feature Type:gene_model
Chromosome:Gm07
Start:550287
stop:551454
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11970AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) | chr5:3863289-3863606 REVERSE LENGTH=105 SoyBaseE_val: 8.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12023PFAM Domain of unknown function (DUF3511) JGI ISS
UniRef100_I1KG94UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KG94_SOYBN SoyBaseE_val: 6.00E-82ISS
UniRef100_Q9LVK8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD10145.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LVK8_ARATH SoyBaseE_val: 3.00E-13ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g20310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g007500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g00960.1   sequence type=CDS   gene model=Glyma07g00960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTCAGATCAAAATCATGCAGGAATGAGAGTCTGCAGATTGAAAACTACAGTGGTGGAAGGGTGGCACCAACAAGCATGCAAGATCTGAGGTCTTATAGTTACAGTGCAAGCTATGCTGGTTCTGCTTATCCATACAAGATAGGTAAGGAAAAGGAAGTGAAGGTGGATAAAGGGAAAAGCACAGTTAGCAATAGCAAAGTATCAAAGAGTTGGAGCTTCAATGACCCTGAGTTGCAGAGGAAGAAGAGGGTGGCTGGCTATAAAATATATTCTGCGGAAGGGAAAATGAAAGGCTCACTAAGGAAGAGTTTGAGGTGGATCAAGAACACATACACTCAAGCTGTCCATGGATGGTGGTGA

>Glyma07g00960.1   sequence type=predicted peptide   gene model=Glyma07g00960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFRSKSCRNESLQIENYSGGRVAPTSMQDLRSYSYSASYAGSAYPYKIGKEKEVKVDKGKSTVSNSKVSKSWSFNDPELQRKKRVAGYKIYSAEGKMKGSLRKSLRWIKNTYTQAVHGWW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo