Report for Sequence Feature Glyma07g00960
Feature Type: gene_model
Chromosome: Gm07
Start: 550287
stop: 551454
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g00960
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G11970 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) | chr5:3863289-3863606 REVERSE LENGTH=105
SoyBase E_val: 8.00E-22 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF12023 PFAM
Domain of unknown function (DUF3511)
JGI ISS
UniRef100_I1KG94 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KG94_SOYBN
SoyBase E_val: 6.00E-82 ISS
UniRef100_Q9LVK8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD10145.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LVK8_ARATH
SoyBase E_val: 3.00E-13 ISS
Expression Patterns of Glyma07g00960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g00960
Paralog Evidence Comments
Glyma08g20310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g00960 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g007500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g00960
Coding sequences of Glyma07g00960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g00960.1 sequence type=CDS gene model=Glyma07g00960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAATTCAGATCAAAATCATGCAGGAATGAGAGTCTGCAGATTGAAAACTACAGTGGTGGAAGGGTGGCACCAACAAGCATGCAAGATCTGAGGTCTTATAGTTACAGTGCAAGCTATGCTGGTTCTGCTTATCCATACAAGATAGGTAAGGAAAAGGAAGTGAAGGTGGATAAAGGGAAAAGCACAGTTAGCAATAGCAAAGTATCAAAGAGTTGGAGCTTCAATGACCCTGAGTTGCAGAGGAAGAAGAGGGTGGCTGGCTATAAAATATATTCTGCGGAAGGGAAAATGAAAGGCTCACTAAGGAAGAGTTTGAGGTGGATCAAGAACACATACACTCAAGCTGTCCATGGATGGTGGTGA
Predicted protein sequences of Glyma07g00960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g00960.1 sequence type=predicted peptide gene model=Glyma07g00960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEFRSKSCRNESLQIENYSGGRVAPTSMQDLRSYSYSASYAGSAYPYKIGKEKEVKVDKGKSTVSNSKVSKSWSFNDPELQRKKRVAGYKIYSAEGKMKGSLRKSLRWIKNTYTQAVHGWW*