Glyma07g00771 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g00771): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g00771): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g00771

Feature Type:	gene_model
Chromosome:	Gm07
Start:	413122
stop:	414534
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g00771

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G11350	AT	Annotation by Michelle Graham. TAIR10: S-domain-1 13 \| chr1:3817725-3820752 REVERSE LENGTH=830	SoyBase	E_val: 4.00E-17	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0016556	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA modification	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0048544	GO-bp	Annotation by Michelle Graham. GO Biological Process: recognition of pollen	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
GO:0030246	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF430	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_B9RQP5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein kinase PBS1, putative n=1 Tax=Ricinus communis RepID=B9RQP5_RICCO	SoyBase	E_val: 4.00E-25	ISS
UniRef100_I1NDP9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1NDP9_SOYBN	SoyBase	E_val: 8.00E-30	ISS

Expression Patterns of Glyma07g00771

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g00771 not represented in the dataset	Glyma07g00771 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g00771 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g005700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g00771

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g00771

Limit To All Plant Sequences

>Glyma07g00771.1   sequence type=CDS   gene model=Glyma07g00771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGCAAATGAAATTGCTGACTGAAGTTGGAGGCAATGTAATGGGAATTTATGGAAAAGCCAACAAGAAAGATGGGAAGACAACAAATGAGATTGAAATTAATAAGCTAGGAGAGGGTGGTTTTGGTCCTGTCTATAAGATGAAAGTAGAAAGCGTGCTAGATTGGAAAAAACGCCACAACATCATTGAAGGCATTGCTCAAGGACTTGTTTATTTACACAAATATTCAAGACTAAAGGCTTGGCAAATATGGAATAAAGGTAGAGCTTTAGAATTGTTAGATCCATCATTGAATAAATCATACATTTCCGATGAAGTACTGAGGTATATTCATATTGGACTAATGTGCGTACAAGATCATGTGACAGACAGACCAACCATGCAAGATGTTGTTTCGTTCCTATCAAACAATAGCGCCCAACTTGGTCAACCAAAGCAGCTAACATTCTTCTTGCATGTGATAGTGGAAGAGCCAAGGTTGCCTAATAGCAACCAAGAAAGTTTTTCCTTGAACGTTGTATCAATTTCCACTATTTATGGTTGA

Predicted protein sequences of Glyma07g00771

Limit To All Plant Sequences

>Glyma07g00771.1   sequence type=predicted peptide   gene model=Glyma07g00771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRQMKLLTEVGGNVMGIYGKANKKDGKTTNEIEINKLGEGGFGPVYKMKVESVLDWKKRHNIIEGIAQGLVYLHKYSRLKAWQIWNKGRALELLDPSLNKSYISDEVLRYIHIGLMCVQDHVTDRPTMQDVVSFLSNNSAQLGQPKQLTFFLHVIVEEPRLPNSNQESFSLNVVSISTIYG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain