SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma07g00700

Feature Type:gene_model
Chromosome:Gm07
Start:376854
stop:379652
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16080AT Annotation by Michelle Graham. TAIR10: Zinc-binding ribosomal protein family protein | chr3:5454892-5455677 FORWARD LENGTH=95 SoyBaseE_val: 9.00E-55ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3475 KOG 60S ribosomal protein L37 JGI ISS
PTHR10768Panther 60S RIBOSOMAL PROTEIN L37 JGI ISS
PF01907PFAM Ribosomal protein L37e JGI ISS
UniRef100_Q6SPR2UniRef Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein L37 n=1 Tax=Glycine max RepID=Q6SPR2_SOYBN SoyBaseE_val: 3.00E-60ISS
UniRef100_Q6SPR2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L37 n=1 Tax=Glycine max RepID=Q6SPR2_SOYBN SoyBaseE_val: 3.00E-60ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g21960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g004900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g00700.2   sequence type=CDS   gene model=Glyma07g00700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAAGGGAACGGGGAGTTTCGGTAAGAGAAGGAACAAGACCCACACCCTCTGTGTGAGGTGTGGCCGCCGCAGTTTCCACCTCCAGAAGAGTCGTTGCGCCGCGTGCGCTTTCCCCGCTGCGCGCACCAGGAAATATAACTGGAGCGTGAAGGCCATTAGGAGAAAGACCACCGGAACTGGAAGGATGAGGTACTTGCGTAACGTGCCCCGTAGATTTAAGAGTGGCTTCAGAGACGGTACCGAAGCTGCACCCAGGAAGAGAGGAGCTGCTGCCTCTACCTAA

>Glyma07g00700.2   sequence type=predicted peptide   gene model=Glyma07g00700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKSGFRDGTEAAPRKRGAAAST*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo