SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g00440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g00440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g00440

Feature Type:gene_model
Chromosome:Gm07
Start:196464
stop:197811
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g00440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22300AT Annotation by Michelle Graham. TAIR10: ribosomal protein S10 | chr3:7885737-7886613 FORWARD LENGTH=241 SoyBaseE_val: 4.00E-17ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005763GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial small ribosomal subunit SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR11700Panther 30S RIBOSOMAL PROTEIN S10 FAMILY MEMBER JGI ISS
PTHR11700:SF5Panther SUBFAMILY NOT NAMED JGI ISS
PF00338PFAM Ribosomal protein S10p/S20e JGI ISS
UniRef100_E9KZP0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S10 n=1 Tax=Vigna radiata RepID=E9KZP0_VIGRA SoyBaseE_val: 7.00E-20ISS
UniRef100_I1KG35UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KG35_SOYBN SoyBaseE_val: 1.00E-85ISS

Expression Patterns of Glyma07g00440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g00440 not represented in the dataset
Glyma07g00440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g00440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g002400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g00440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g00440
>Glyma07g00440.1   sequence type=CDS   gene model=Glyma07g00440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTCCAAATCAGTTACAAAGATTGAATGCAACTGTTTTTTTTATCAAGAGAGATACAGTTGGCCTGAATCACGAGTCTTATTTACTGTGTTACGATCACCTCATATTGATAAAAAGTCCAGAGAACAATTTGAAATGGAAATAAAGAAAAAATTTCTGATCATAAAAACACAAAAGCATGAATTGCGCAAGAAGAATAAAACCTCATATAGCTTGGCACCTTCCCTTATTCTCTCCTTCTTTTTGGTAGTGCTAAGTAATGGAAAATCTCCTATGGCTATTAAGGGTCAGCTACCGAAAGAGAGAATCGGTCTAAGTGCGGGGATCCAAATCCTACTTGCTGAAACTGGAGAGAAACCAAATATATCTATCATATGA
Predicted protein sequences of Glyma07g00440
>Glyma07g00440.1   sequence type=predicted peptide   gene model=Glyma07g00440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSKSVTKIECNCFFYQERYSWPESRVLFTVLRSPHIDKKSREQFEMEIKKKFLIIKTQKHELRKKNKTSYSLAPSLILSFFLVVLSNGKSPMAIKGQLPKERIGLSAGIQILLAETGEKPNISII*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo