|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G52370 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L22p/L17e family protein | chr1:19507052-19508699 FORWARD LENGTH=269 | SoyBase | E_val: 1.00E-13 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0015934 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| PF00237 | PFAM | Ribosomal protein L22p/L17e | JGI | ISS | |
| UniRef100_Q9C828 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast 50S ribosomal protein L22, putative; 25606-24374 n=1 Tax=Arabidopsis thaliana RepID=Q9C828_ARATH | SoyBase | E_val: 2.00E-11 | ISS |
| UniRef100_UPI000233A2BE | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A2BE related cluster n=1 Tax=unknown RepID=UPI000233A2BE | SoyBase | E_val: 3.00E-38 | ISS |
|
Glyma06g48426 not represented in the dataset |
Glyma06g48426 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g325400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g48426.1 sequence type=CDS gene model=Glyma06g48426 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGTAAGCTTGTCTCCCTAAGGCAGGACCATCAACCATCTAGCAATTCTTCATTCCAGAGTCCAAAGAAGGTCAACTTGGTTGCTGCTCTGGTTCGTGGTATGCTTGTTAAAGATGCATCGATGCAGTTGGAATCGACAATAAAACGAGCAGCAAAAACTGTATATCAGGTTAAAGAGTTCCATAGAAGAGTTGGTTTTGAGGTAGCAAGTGCTGACAAGATGGCTAAGTCATGCATGGTTTATTTTGAAATGCATCTATCCCTAAGGAAAAAAATAATTACAAAAGCTTTTAATGGTAGTTATAGTATCTACAAGGAAACTTTTTGTAACCAGGTCTATTGCCTTTTTGTTTGA
>Glyma06g48426.1 sequence type=predicted peptide gene model=Glyma06g48426 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGKLVSLRQDHQPSSNSSFQSPKKVNLVAALVRGMLVKDASMQLESTIKRAAKTVYQVKEFHRRVGFEVASADKMAKSCMVYFEMHLSLRKKIITKAFNGSYSIYKETFCNQVYCLFV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||