SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g48180

Feature Type:gene_model
Chromosome:Gm06
Start:50455449
stop:50458517
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g48180
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G10080AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G13530.1); Has 120 Blast hits to 114 proteins in 21 species: Archae - 2; Bacteria - 4; Metazoa - 0; Fungi - 12; Plants - 100; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). | chr4:6300454-6302560 REVERSE LENGTH=325 SoyBaseE_val: 2.00E-26ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
UniRef100_I1KFX5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KFX5_SOYBN SoyBaseE_val: 5.00E-154ISS

Expression Patterns of Glyma06g48180
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g48180
ParalogEvidenceComments
Glyma04g12240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g48180 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g323500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g48180
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g48180
>Glyma06g48180.1   sequence type=CDS   gene model=Glyma06g48180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGACGCAAAACGCGAAGTGGAAGAGTGGGAATTGCTCCATCCAAACAACGACGACGATTCAATCGTGTTCGCTGGGCCCCCACTGGACTCTATCCGCCCCGATCACTTCTCTCTCCTAGACGACAACCTTAACCCCAATTCCAGTTGCAGCTCCAATTCCTCCTCCGAGGTCGATCGCAACTTCGACGATTCCTATGTCGCCAATCAGATATTCCCCAATCAGAGCCTCTGGAACGGAGATTCCGATTCCGATTCCGATATTCCCCGATCAGAGCCTGTGGTGGAAGAAGCTCAAGAAGAGAAAATACAACAAGTGGTTGAGAAAGACAAGAGATTGGTGTGGTGGAAGGTTCCTTTTGAGGTTTTGAGGTATTGGGTTAACCCTCTTCCTCTGTCTCTGCCTCTCTCTGTCGCTGCCGCTGCTGCTTTTCTGGGACTGTTCTTGCTTGGACGGACCTTGTACAGAATGAAGCGCAAGACTCAAACTTTTAACCTCAACCTCGCTCTCGATGATAAGAAGGTGTCTCAGCTCATGGGTCGTGTTGCTCGTCTTAATGAAGCATTTTCAGTAGTGAGACGTGTTCCCATAGTGCGACCACCATCTCTGCCAGCTTCAAGTGTGACTCTGAGGCCTGTGATAAGTATGAGATGA
Predicted protein sequences of Glyma06g48180
>Glyma06g48180.1   sequence type=predicted peptide   gene model=Glyma06g48180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDDAKREVEEWELLHPNNDDDSIVFAGPPLDSIRPDHFSLLDDNLNPNSSCSSNSSSEVDRNFDDSYVANQIFPNQSLWNGDSDSDSDIPRSEPVVEEAQEEKIQQVVEKDKRLVWWKVPFEVLRYWVNPLPLSLPLSVAAAAAFLGLFLLGRTLYRMKRKTQTFNLNLALDDKKVSQLMGRVARLNEAFSVVRRVPIVRPPSLPASSVTLRPVISMR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo