SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g48130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g48130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g48130

Feature Type:gene_model
Chromosome:Gm06
Start:50428689
stop:50431207
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G45775AT Annotation by Michelle Graham. TAIR10: Ribosomal L5P family protein | chr5:18565281-18566496 REVERSE LENGTH=182 SoyBaseE_val: 8.00E-127ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0397 KOG 60S ribosomal protein L11 JGI ISS
PTHR11994Panther 60S RIBOSOMAL PROTEIN L11-RELATED JGI ISS
PF00281PFAM Ribosomal protein L5 JGI ISS
PF00673PFAM ribosomal L5P family C-terminus JGI ISS
UniRef100_C6SXI7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6SXI7_SOYBN SoyBaseE_val: 2.00E-129ISS
UniRef100_P46287UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L11 n=1 Tax=Medicago sativa RepID=RL11_MEDSA SoyBaseE_val: 2.00E-128ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g48130 not represented in the dataset

Glyma06g48130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g323000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g48130.1   sequence type=CDS   gene model=Glyma06g48130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAGAGAAGAAACTTTCGAACCCAATGAGGGAGATAAAAGTGCAGAAGCTCGTTCTCAATATCTCTGTTGGCGAGAGTGGAGATCGTCTCACCAGAGCCGCCAAGGTGTTGGAACAACTTAGTGGCCAAACCCCAGTGTTTTCCAAAGCAAGGTACACTGTTCGTTCCTTTGGGATTAGAAGAAATGAGAAGATTGCATGCTATGTCACTGTCAGAGGTGACAAGGCAATGCAACTTTTGGAGAGTGGTTTGAAGGTTAAGGAATATGAACTTCTCAGAAGGAATTTCAGTGATACTGGTTGCTTCGGCTTTGGTATTCAGGAGCATATCGATTTGGGAATCAAGTATGATCCTTCAACTGGTATTTATGGAATGGATTTCTTTGTTGTTCTGGAGCGTCCTGGCTATCGTGTTGGACGTCGCCGCAGGTGCAAGTCCCGGGTTGGAATTCAGCACCGTGTCACAAAGGAGGATGCTATGAAGTGGTTCCAGGTGAAATATGAGGGAGTGATCCTTAACAAGTCCCAGGCAATTGTTTAG

>Glyma06g48130.1   sequence type=predicted peptide   gene model=Glyma06g48130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKSQAIV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo