Glyma06g48040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g48040

Feature Type:	gene_model
Chromosome:	Gm06
Start:	50368240
stop:	50370720
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g48040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G56170	AT	Annotation by Michelle Graham. TAIR10: LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 \| chr5:22736072-22737108 FORWARD LENGTH=168	SoyBase	E_val: 2.00E-59	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0090406	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: pollen tube	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1KFV9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KFV9_SOYBN	SoyBase	E_val: 1.00E-114	ISS
UniRef100_Q9ZWN0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GPI-anchored protein n=1 Tax=Vigna radiata RepID=Q9ZWN0_VIGRA	SoyBase	E_val: 7.00E-82	ISS

Expression Patterns of Glyma06g48040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g48040

Paralog	Evidence	Comments
Glyma04g12480	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g48040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g322000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g48040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g48040

Limit To All Plant Sequences

>Glyma06g48040.1   sequence type=CDS   gene model=Glyma06g48040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTTTCTTTCAACCAAAGCTTCTGCCTTTCTTCTTCGCTTCTCCTTCTCCTCATGGCCCTCTGTGTTTCTTCTCTTTCTGACACCGTTTTCAACTCTCAAGCAGCGCATACCGCTCGGAACCTTCTTCAGGCTAAAAAAAGTTGTTCTGTGAATTTCGAGTTTTTAAACTACACAGTAATCACAAGCAAATGCAAAGGACCCCATTACCCTCCCAAAGAATGTTGTGGGGCTTTTAAAGAATTTGCTTGCCCTTATGTCGATGTATTAAATGATTTAACGAACGAGTGCGCCTCAACCATGTTTAGTTACATTAATCTCTATGGAAAATACCCTCCTGGCCTCTTTGCTAGTGAGTGTCATGAAGGGAAACTTGGTCTCGCTTGTCCTGCATTGCCACCGTCTGCATCAGCAGATGACACAGCAAATCAAGTTGTACACTGTCCATCTCTATTGCTGATGCTCACAGCCTGCTTCTTAATCTTGTTATTTTGA

Predicted protein sequences of Glyma06g48040

Limit To All Plant Sequences

>Glyma06g48040.1   sequence type=predicted peptide   gene model=Glyma06g48040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFSFNQSFCLSSSLLLLLMALCVSSLSDTVFNSQAAHTARNLLQAKKSCSVNFEFLNYTVITSKCKGPHYPPKECCGAFKEFACPYVDVLNDLTNECASTMFSYINLYGKYPPGLFASECHEGKLGLACPALPPSASADDTANQVVHCPSLLLMLTACFLILLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain