Glyma06g47900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g47900

Feature Type:	gene_model
Chromosome:	Gm06
Start:	50280490
stop:	50281406
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g47900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16520	AT	Annotation by Michelle Graham. TAIR10: UDP-glucosyl transferase 88A1 \| chr3:5618807-5620833 REVERSE LENGTH=451	SoyBase	E_val: 1.00E-37	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0008194	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016758	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups	SoyBase	N/A	ISS
GO:0080043	GO-mf	Annotation by Michelle Graham. GO Molecular Function: quercetin 3-O-glucosyltransferase activity	SoyBase	N/A	ISS
GO:0080044	GO-mf	Annotation by Michelle Graham. GO Molecular Function: quercetin 7-O-glucosyltransferase activity	SoyBase	N/A	ISS
GO:0080045	GO-mf	Annotation by Michelle Graham. GO Molecular Function: quercetin 3'-O-glucosyltransferase activity	SoyBase	N/A	ISS
GO:0080046	GO-mf	Annotation by Michelle Graham. GO Molecular Function: quercetin 4'-O-glucosyltransferase activity	SoyBase	N/A	ISS
PTHR11926	Panther	GLUCOSYL/GLUCURONOSYL TRANSFERASES	JGI		ISS
PTHR11926:SF15	Panther	UDP-GLUCURONOSYLTRANSFERASE RELATED	JGI		ISS
UniRef100_E9M5F8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glycosyltransferase GT19J14 n=1 Tax=Pueraria montana var. lobata RepID=E9M5F8_PUEML	SoyBase	E_val: 1.00E-133	ISS
UniRef100_I1KFU6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KFU6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g47900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g47900

Paralog	Evidence	Comments
Glyma04g12770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g47900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g47900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g47900

Limit To All Plant Sequences

>Glyma06g47900.1   sequence type=CDS   gene model=Glyma06g47900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACAAGAAGACACAGTAGTGTTGTATCCAGCACCAGGCATAGGCCATATTGTTTCCATGGTTGAACTCGCCAAGCTTCTCCAAACACACAGTTATTCAATCATAATCCTCCTTTCCACCGGCTTCCTCGACCATCCCTCCGTCGACGCCTATGTCCACCGCATCTCCACCTCCCACCCTTACATCTCCTTCCACCGCCTCCCCCACATCGCCCCCACCACCACCACCACGGTTAGCTTCGCCGCAAAGGGCTTCAACTTCATCAAAAGAAACACCCCCAACGTCGCCACCACCCTCGCCAAAATCTCCAAATCCACCAGCACCACCATAAAAGCCTTCATAACCGACCTCTTTTGCTTCTCTGTCACGGAAACAACTTCCTCAATGGGAATCCCAGTTTACTACTTCTTCGCTTCTGGTGCTGCCGGTCTCGCAATCGTCTCGTACTTCCCGAAACTCCATGAAGAAACGAACGTGTCGTTTAAGGACATGGTCGGTGTGGAAGTGCGTGTGCCGGGTAACGCGCCGCTGAAGGCCGTGAACATGCCGCAACCCATGTTGGACAGGGACGACTCTGCGTACTGGGACATGCTGTATCTGGGCACGCACCTTGGTGAAGCGAGTGGGGTTGTGGTGAACACGTTTCCGGAGCTTGAGCCTCTGGCGGTTAACGCCGTAGCCGGTGGCGCATGCTTTGCAGACGCGAAAGAAGCACCTCCGGTTTTCTACATCGGTCCACTCATCGCTGAACCACAACTATCAGGTCTTGTCCTTTTCGTTGAATAA

Predicted protein sequences of Glyma06g47900

Limit To All Plant Sequences

>Glyma06g47900.1   sequence type=predicted peptide   gene model=Glyma06g47900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQEDTVVLYPAPGIGHIVSMVELAKLLQTHSYSIIILLSTGFLDHPSVDAYVHRISTSHPYISFHRLPHIAPTTTTTVSFAAKGFNFIKRNTPNVATTLAKISKSTSTTIKAFITDLFCFSVTETTSSMGIPVYYFFASGAAGLAIVSYFPKLHEETNVSFKDMVGVEVRVPGNAPLKAVNMPQPMLDRDDSAYWDMLYLGTHLGEASGVVVNTFPELEPLAVNAVAGGACFADAKEAPPVFYIGPLIAEPQLSGLVLFVE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain