Glyma06g47780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g47780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g47780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g47780

Feature Type:	gene_model
Chromosome:	Gm06
Start:	50181528
stop:	50183596
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g47780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G33590	AT	Annotation by Michelle Graham. TAIR10: Leucine-rich repeat (LRR) family protein \| chr1:12177788-12179221 FORWARD LENGTH=477	SoyBase	E_val: 0	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF510	Panther		JGI		ISS
PF00560	PFAM	Leucine Rich Repeat	JGI		ISS
PF08263	PFAM	Leucine rich repeat N-terminal domain	JGI		ISS
UniRef100_C6ZS00	UniRef	Annotation by Michelle Graham. Best UniRef hit: Disease resistance protein/LRR protein-related protein n=1 Tax=Glycine max RepID=C6ZS00_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_G7IYL0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like protein kinase n=2 Tax=Medicago truncatula RepID=G7IYL0_MEDTR	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g47780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g47780 not represented in the dataset	Glyma06g47780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g47780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g319700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g47780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g47780

Limit To All Plant Sequences

>Glyma06g47780.1   sequence type=CDS   gene model=Glyma06g47780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCTGTACCACTCCTCCACCACCACCACCACCACCACCATCTTCACCGTCATATTCCTCCTCCTTGCAATATTATTCACTCTCACACCCCACAAGGCCAACGGTGCCACGTGTCACCCTGAGGAAGAAGCGGGCCTGTTGGGCTTCAAATCCGGTATCCGATCCGACCCGTCCGGCCTGCTCAGTAACTGGATATCGGGTACGGACTGCTGCACATGGACCGGAGTAGAATGCCACTATAACAGCACCCGGGTCCAAAGATTATTCTTAACGGGTCAAAAACCCGAAACCATCTTATCGGGTACCATCTCACCCACCCTCTCAAAACTCAAACTCCTCGATGGACTCTACCTCATAAACCTCATCAACATTTCGGGTCCCTTCCCAAATTTTCTTTTCCAACTTCCAAATCTCCAATTTATCTATCTAGAAAACAACAATCTCTCGGGTCGAATACCCGATAACATCGGTAACCTTACCCGATTAGATGTACTCAGTTTAACTGGTAACCGGTTCATCGGACCCGTACCGAGTTCAATAACCAAGTTGACTCAGCTCACTCAGCTCAAACTCGGTAACAATTTTCTCACCGGAACAGTTCCCCAAGGAATTGCCAAGCTCGTTAATTTAACCTATTTGAGTCTCGAAGGAAACCAACTTGAAGGTACCATACCGGATTTTTTCTCTTCCTTCACGGATCTTCGGATTCTTAATTTTTCTTACAACAAATTTTCCGGGAATATCCCCAACTCGATTTCTTCCCTGGCGCCGAAACTGACGTACTTGGAGCTTGGGCACAACTCACTTTCCGGGAAAATCCCTGATTTTCTGGGAAAATTCAAGGCGCTTGACACGCTTGACCTGTCATGGAACAAGTTTTCCGGAACGGTCCCTGCGAGTTTCAAGAACCTGACGAAAATCTTCAACCTGAACCTCTCCAACAACCTCCTGGTGGACCCGTTCCCCGAGATGAACGTGAAAGGGATAGAATCGTTGGACTTGTCGAACAACAGTTTTCACCTGGGGAGCATTCCCAAGTGGGTGGCTTCGTCGCCGATAATATTCTCTCTGAAGCTTGTGAATTGCGGAATAAAGATGAGGCTAGAGGATTTTAAGCCTTCGGAGACTTATTTCTATGATTTTATTGATCTTTCGGGGAATGAAATTTCAGGGAGTGCAATTGGGTTGGTGAATAGTACTGAGTATTTGGTGGGGTTTTGGGCTTCGGGGAACAAGTTGAAGTTTGATTTGGGGAAGTTAAGGTTTGGGGAGAGGTTTAAGTTTTTGGATTTGTCTCGTAATTGGGTGTTTGGGAAGGTTCCAAACAGTGTTGTTGGGCTTGAGAAGTTGAATGTTAGCTATAACCATCTTTGTGGTCAGCTTCCCAAGAATAAGTTTCCGGCAAGTGCTTTTGTTGGAAATGATTGTCTCTGTGGTTCTCCTTTGCCACCCTGCAACAAAGCATAA

Predicted protein sequences of Glyma06g47780

Limit To All Plant Sequences

>Glyma06g47780.1   sequence type=predicted peptide   gene model=Glyma06g47780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLYHSSTTTTTTTIFTVIFLLLAILFTLTPHKANGATCHPEEEAGLLGFKSGIRSDPSGLLSNWISGTDCCTWTGVECHYNSTRVQRLFLTGQKPETILSGTISPTLSKLKLLDGLYLINLINISGPFPNFLFQLPNLQFIYLENNNLSGRIPDNIGNLTRLDVLSLTGNRFIGPVPSSITKLTQLTQLKLGNNFLTGTVPQGIAKLVNLTYLSLEGNQLEGTIPDFFSSFTDLRILNFSYNKFSGNIPNSISSLAPKLTYLELGHNSLSGKIPDFLGKFKALDTLDLSWNKFSGTVPASFKNLTKIFNLNLSNNLLVDPFPEMNVKGIESLDLSNNSFHLGSIPKWVASSPIIFSLKLVNCGIKMRLEDFKPSETYFYDFIDLSGNEISGSAIGLVNSTEYLVGFWASGNKLKFDLGKLRFGERFKFLDLSRNWVFGKVPNSVVGLEKLNVSYNHLCGQLPKNKFPASAFVGNDCLCGSPLPPCNKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain