SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g47041): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g47041): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g47041

Feature Type:gene_model
Chromosome:Gm06
Start:49577827
stop:49579311
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10400AT Annotation by Michelle Graham. TAIR10: RNA recognition motif and CCHC-type zinc finger domains containing protein | chr3:3232636-3233421 FORWARD LENGTH=261 SoyBaseE_val: 2.00E-67ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0032502GO-bp Annotation by Michelle Graham. GO Biological Process: developmental process SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG4209 KOG Splicing factor RNPS1, SR protein superfamily JGI ISS
PTHR24011Panther FAMILY NOT NAMED JGI ISS
PTHR24011:SF274Panther JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
PF00098PFAM Zinc knuckle JGI ISS
UniRef100_B9SUC6UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA binding motif protein, putative n=1 Tax=Ricinus communis RepID=B9SUC6_RICCO SoyBaseE_val: 7.00E-73ISS
UniRef100_UPI000233A8F0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A8F0 related cluster n=1 Tax=unknown RepID=UPI000233A8F0 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g47041 not represented in the dataset

Glyma06g47041 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g313200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g47041.1   sequence type=CDS   gene model=Glyma06g47041   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAAAAGCAAAGCGAAAAAGAAAAATAGTGATAGCGATGAAGACGACGACGTTTTCTACTACCGCTATAGCAGCGTCAACCCTACCCAAACTCAAACTCAAACCCAAACCCTACAACACAATCCAAATCCCAAATCCAACAACAACAAGGGATCTTCGTCTTCTTCCTTGGCTCCGTCGAAATCAACGTTGTACGTTTCGAACATCGACTACTCCCTCACGAACTCCGACCTCCACACGCTCTTCTCCACCTTCGGCCGCGTCGCGCGCGTCACCGTCCTCAAGGACCGCCACACGCGCCTCAGCCGCGGCGTGGCCTTCGTCCAGTTCGTGTCGCGCCACGACGCGCACGATGCGGCCGCGCAGATGGACGGGAAGGTGCTCAACGGCCGCACCCTCGCCGCCTCCATCGCCGCCGACAACGGCCGCGCCCCCGAGTTCATCCGCAAGCGCGTCTACCGCGACACCGATCGCTGCTTCGAGTGCGGAGAGCAAGGGCACCTCTCGTACGACTGCCCGCGTAATCAGCTCGGCCCCCGCCAACGCCCCGAGCCTAAACGCCCCCGCCGTGGGCCCCACCCCCACCCCCACCGCCATCGCCATAACGACAATGACGATGCCGGAGGCGACGATGACGATTATGACGGCGGGGCTGAGCGGTTTGAGGATGATAATTGGGCTTCTGTTGTGGATGACGGTGCTGGTGAGAGGCTCTTGGCGGGAAACCAACATGATGGTGATGGTGTTGTGGCTGGAAAGAGTAAGAAGAAAAAGAACAAGGGTGGGTACTTCAGTGACGAGAGTGATGATGATGAATAG

>Glyma06g47041.1   sequence type=predicted peptide   gene model=Glyma06g47041   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKSKAKKKNSDSDEDDDVFYYRYSSVNPTQTQTQTQTLQHNPNPKSNNNKGSSSSSLAPSKSTLYVSNIDYSLTNSDLHTLFSTFGRVARVTVLKDRHTRLSRGVAFVQFVSRHDAHDAAAQMDGKVLNGRTLAASIAADNGRAPEFIRKRVYRDTDRCFECGEQGHLSYDCPRNQLGPRQRPEPKRPRRGPHPHPHRHRHNDNDDAGGDDDDYDGGAERFEDDNWASVVDDGAGERLLAGNQHDGDGVVAGKSKKKKNKGGYFSDESDDDE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo