Glyma06g46990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g46990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g46990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g46990

Feature Type:	gene_model
Chromosome:	Gm06
Start:	49529796
stop:	49536049
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g46990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G53530	AT	Annotation by Michelle Graham. TAIR10: vacuolar protein sorting 26A \| chr5:21746275-21748156 REVERSE LENGTH=302	SoyBase	E_val: 0	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0007034	GO-bp	Annotation by Michelle Graham. GO Biological Process: vacuolar transport	SoyBase	N/A	ISS
GO:0008333	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosome to lysosome transport	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0042147	GO-bp	Annotation by Michelle Graham. GO Biological Process: retrograde transport, endosome to Golgi	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005771	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: multivesicular body	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0030904	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: retromer complex	SoyBase	N/A	ISS
GO:0043231	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3063	KOG	Membrane coat complex Retromer, subunit VPS26	JGI		ISS
PTHR12233	Panther	VACUOLAR PROTEIN SORTING 26 RELATED	JGI		ISS
PF03643	PFAM	Vacuolar protein sorting-associated protein 26	JGI		ISS
UniRef100_I1KFL5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KFL5_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q3HRZ1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting-associated protein 26-like protein n=1 Tax=Solanum tuberosum RepID=Q3HRZ1_SOLTU	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g46990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g46990 not represented in the dataset	Glyma06g46990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g46990

Paralog	Evidence	Comments
Glyma04g15160	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g46990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g312800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g46990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g46990

Limit To All Plant Sequences

>Glyma06g46990.1   sequence type=CDS   gene model=Glyma06g46990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTACCTTCTTGGAGCTTTCAAGCCTGCATGTAATGTCGTGATCACGTTTAACGACGGGAAGAACCGAAAGCAGGTCCCTTTTAAAAAAGAAAATGGTCAAATGGTTACAGTCCCACTTTTCCAAAGTCAAGAAAACATTGCTGGGAAGATTACAATAGAACCAATGCAAGGGAAGAAGATTGATCACAATGGTGTAAAAGTTGAGCTCCTTGGACAGATAGAGATGTATTTTGACAGAGGAAATTTTTATGACTTTACTTCCCTTGTACGAGAACTAGATGTTCCTGGAGAAATCTATGAGAGGAAAACATATGCATTTGAATTTTCTACTGTTGAAATGCCATATGAAACATATAATGGGGTGAATGTAAGGCTTAGATATGTGTTGAAAGTGACCATTAATCGTGGCTATGCTGGAAGCGTAGTAGAATACCAGGATTTTGTGGTTCGCAACTATTCTCCACCTCCACAAATTAACAATAGCATCAAGATGGAAGTTGGAATTGAAGATTGTCTGCACATCGAATTTGAATACAACAAAAGCAAGTATCATCTGAAAGATGTCATCATTGGCAAGATATACTTCTTACTTGTCAGAATCAAGATAAAAAACATGGATCTTGAGATTAGGCGTCGAGAATCCACAGGATCAGGGACCAACACCCATGTTGAGACAGAAACATTGGCTAAATTTGAGTTGATGGATGGTGCTCCTGTTAGAGGTGAATCAATTCCAATCAGATTGTTCCTCAGTCCCTATGAGCTGACCCCAACACATCGTAACATTAATAACAAATTCAGTGTGAAGTACTTTTTAAATCTTGTGTTGGTTGATGAAGAGGACAGGCGATATTTCAAGCAGCAGGAAATCACAATGTATAGGCTGCAGGAAGAAACTTCATGA

Predicted protein sequences of Glyma06g46990

Limit To All Plant Sequences

>Glyma06g46990.1   sequence type=predicted peptide   gene model=Glyma06g46990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNYLLGAFKPACNVVITFNDGKNRKQVPFKKENGQMVTVPLFQSQENIAGKITIEPMQGKKIDHNGVKVELLGQIEMYFDRGNFYDFTSLVRELDVPGEIYERKTYAFEFSTVEMPYETYNGVNVRLRYVLKVTINRGYAGSVVEYQDFVVRNYSPPPQINNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIIGKIYFLLVRIKIKNMDLEIRRRESTGSGTNTHVETETLAKFELMDGAPVRGESIPIRLFLSPYELTPTHRNINNKFSVKYFLNLVLVDEEDRRYFKQQEITMYRLQEETS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain