Glyma06g46250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g46250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g46250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g46250

Feature Type:	gene_model
Chromosome:	Gm06
Start:	48905388
stop:	48911888
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g46250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G21700	AT	Annotation by Michelle Graham. TAIR10: Ras-related small GTP-binding family protein \| chr3:7644581-7646190 FORWARD LENGTH=292	SoyBase	E_val: 9.00E-63	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0090404	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: pollen tube tip	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
PTHR24073	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24073:SF279	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00071	PFAM	Ras family	JGI		ISS
UniRef100_G7JDG8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Septum-promoting GTP-binding protein n=1 Tax=Medicago truncatula RepID=G7JDG8_MEDTR	SoyBase	E_val: 6.00E-64	ISS
UniRef100_I1KFD7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KFD7_SOYBN	SoyBase	E_val: 8.00E-72	ISS

Expression Patterns of Glyma06g46250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g46250 not represented in the dataset	Glyma06g46250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g46250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g306100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g46250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g46250

Limit To All Plant Sequences

>Glyma06g46250.1   sequence type=CDS   gene model=Glyma06g46250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGATCTAACAAGTCGATGCACATCAAACAGTGTCGTGGAATGGTACAAAGAAGCCAGGAAATGGAATCAAACGACAATTCCAGTGTTGATTGGAACCAAGTTTGATGATTTCATTCAGCTCTGTATTGATTTGCAATGGACCATAGCCAATGAGGCAAGAAATTATGCAAAGGCCCTCAATGCCACCTTGTTCTTTTCAAGTGCAACCTACAACATCAATGTGAACAAGATCTTCAAGTTCATCACTGCTAAACTCTTTGACCTACCATGGACAGTGGAGAGGAATCTAACTGTTGGGGAACCCATCATTGACTTCTAA

Predicted protein sequences of Glyma06g46250

Limit To All Plant Sequences

>Glyma06g46250.1   sequence type=predicted peptide   gene model=Glyma06g46250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFDLTSRCTSNSVVEWYKEARKWNQTTIPVLIGTKFDDFIQLCIDLQWTIANEARNYAKALNATLFFSSATYNINVNKIFKFITAKLFDLPWTVERNLTVGEPIIDF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain