SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g46180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g46180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g46180

Feature Type:gene_model
Chromosome:Gm06
Start:48845947
stop:48850170
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09600AT Annotation by Michelle Graham. TAIR10: succinate dehydrogenase 3-1 | chr5:2979777-2980527 FORWARD LENGTH=186 SoyBaseE_val: 1.00E-26ISS
GO:0006121GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial electron transport, succinate to ubiquinone SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005749GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex II SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000104GO-mf Annotation by Michelle Graham. GO Molecular Function: succinate dehydrogenase activity SoyBaseN/AISS
GO:0016627GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors SoyBaseN/AISS
PTHR10978Panther SUCCINATE DEHYDROGENASE CYTOCHROME B560 JGI ISS
PF01127PFAM Succinate dehydrogenase/Fumarate reductase transmembrane subunit JGI ISS
UniRef100_G7JDI5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Succinate dehydrogenase subunit n=1 Tax=Medicago truncatula RepID=G7JDI5_MEDTR SoyBaseE_val: 6.00E-95ISS
UniRef100_I1KFD0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KFD0_SOYBN SoyBaseE_val: 8.00E-175ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g46180 not represented in the dataset

Glyma06g46180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g10590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g305600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g46180.1   sequence type=CDS   gene model=Glyma06g46180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTGGCTCCTCCGATCCACCAAGTCTAAGTTCCTCTCTTCCTCTTCCTCTTCTTCTCTTTCTAGAACCTTCCCCTCTCTCCCTCGCCCTCAGATTGGAGCCATCTCTCCCCTCCCCGATCTCTTCCACCGCAACACCGCCACCATGCCTTTCGCGAAGGAAAACGCTTCCGGTGGAAACTTGACCGGTCTTCCCAAAGTTCCCGCGAATAAGCTTGGCAGTGATTCTGATGCGACCAATTCTTCGAGGTACAAAGCTTCTGGACTGAACACCAATGTGCTGGCTGGAGCTAGATATGTCTCTAGAGTTTGGGCTGCACAGGGTCAAATGCCATTGGGAGTCAATACTGTGATGGCTAGAAGTTTTGAGAGAAGTATGGAAGCTGGCACATTGGGAATGATTGGTCATAAACGTTTTATGAGTGACATCCCAAGTAAAACCAGTGAGACAAACCCATCTGGTTTTCGTCCGTTATCTCCTCATCTTCCTCTTTATCAGCCCCAACTTTCTTCGACCCTCTCAATTTTCAATAGAATTGCTGGAGCTTTCCTAGCTGGTGTCATTTTGGTTTTTTATATGATCTATATGAAGTTGGGTTTGGTTAGCCTCACCTATGACTCTTTCTACCAGTTCATATTTTATTCATCGAAACTCAACCTACTTGTCATGGAGATTTCTGCCTTAGCCGTGTCCTATCATCTGTATAGTGCAATTCGTCATTTATTCTTATGA

>Glyma06g46180.1   sequence type=predicted peptide   gene model=Glyma06g46180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSWLLRSTKSKFLSSSSSSSLSRTFPSLPRPQIGAISPLPDLFHRNTATMPFAKENASGGNLTGLPKVPANKLGSDSDATNSSRYKASGLNTNVLAGARYVSRVWAAQGQMPLGVNTVMARSFERSMEAGTLGMIGHKRFMSDIPSKTSETNPSGFRPLSPHLPLYQPQLSSTLSIFNRIAGAFLAGVILVFYMIYMKLGLVSLTYDSFYQFIFYSSKLNLLVMEISALAVSYHLYSAIRHLFL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo