SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g45960

Feature Type:gene_model
Chromosome:Gm06
Start:48685649
stop:48686850
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g45960
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54200AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr3:20065731-20066438 FORWARD LENGTH=235 SoyBaseE_val: 7.00E-17ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_C6SZX5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZX5_SOYBN SoyBaseE_val: 1.00E-125ISS
UniRef100_Q19QU4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plant cell wall protein SlTFR88 n=1 Tax=Solanum lycopersicum RepID=Q19QU4_SOLLC SoyBaseE_val: 4.00E-19ISS

Expression Patterns of Glyma06g45960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g45960 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g303300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g45960
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g45960
>Glyma06g45960.2   sequence type=CDS   gene model=Glyma06g45960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTCGACACAATATTAATCCAATAGGATCACAATTTTTCTTGCGTACACCCGCATTGTTTTTTCCCCACAAGCAAGTTTGCAAAGGCAATAATCTCTATTACCCTCATTATCCAAAATCAGAAAAAATGGCCACTAGAGGCCTCAAAATTTGCTTGGCCGTGTCCTCTCTTTTCTTGATCATTCTTGCCATCGTTATTGTGACCTTAATTTTGACCATCTTTAAACCCAAGAACCCAGATATATTTCTCCACCCAGTTGACCTAGAAAACTTTCAATTGCTTTCACCTAATACAACTAGTGCACCCTTAGGCATAGTGATCACAATTGTGAACCCTAATTATGGAAACTTCAAGTACGTGAATTCCAGTGGCTATCTTAAATATCGTGACACCATTATAGCCGAAGTTCCATTGGGGATAAGATCATTCCCTGCTCGTAGCACTACCAATGTGAGCACTACTGTGGGTATTATGACCGATAAATTGATACAAGATCCAAAGTTTTTGTCAGATATTGAAGGTGGGGTGTTCAATTTGACAGCAGAGGCCACACTTCCTGGGAAAGTGACCATGATCAAGATTTTAAGGCTTAAGGCCAAGATTTATATCTCTTGTGGCGTCTCTTTCAACATAATTGCTGTGGATGCTAGTTCCAGCTGCATGTCCAAAATCAAATTGTGA
Predicted protein sequences of Glyma06g45960
>Glyma06g45960.2   sequence type=predicted peptide   gene model=Glyma06g45960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRHNINPIGSQFFLRTPALFFPHKQVCKGNNLYYPHYPKSEKMATRGLKICLAVSSLFLIILAIVIVTLILTIFKPKNPDIFLHPVDLENFQLLSPNTTSAPLGIVITIVNPNYGNFKYVNSSGYLKYRDTIIAEVPLGIRSFPARSTTNVSTTVGIMTDKLIQDPKFLSDIEGGVFNLTAEATLPGKVTMIKILRLKAKIYISCGVSFNIIAVDASSSCMSKIKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo