SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g45850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g45850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g45850

Feature Type:gene_model
Chromosome:Gm06
Start:48589050
stop:48591866
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G03510AT Annotation by Michelle Graham. TAIR10: RING membrane-anchor 1 | chr4:1557905-1558654 REVERSE LENGTH=249 SoyBaseE_val: 4.00E-64ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0032527GO-bp Annotation by Michelle Graham. GO Biological Process: protein exit from endoplasmic reticulum SoyBaseN/AISS
GO:0032940GO-bp Annotation by Michelle Graham. GO Biological Process: secretion by cell SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG0823 KOG Predicted E3 ubiquitin ligase JGI ISS
PTHR12313Panther RNF5 JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_C6T8R2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T8R2_SOYBN SoyBaseE_val: 7.00E-179ISS
UniRef100_Q6R567UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase RMA1H1 n=1 Tax=Capsicum annuum RepID=RMA1_CAPAN SoyBaseE_val: 6.00E-74ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g45850 not represented in the dataset

Glyma06g45850 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g293400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g45850.1   sequence type=CDS   gene model=Glyma06g45850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTTAGATCACTTTGAGGAGACTGTGCACCAAAAAGGAAATTGGAAATCTTCCAGTGAAATCATTGCAGATTCTGATAGAAATGCCTCTGGTGACTTTGACTGCAACATCTGCCTGGAGTGTGTGCAAGATCCAGTGGTGACACTTTGTGGTCATCTTTATTGCTGGCCCTGCATATACAAATGGCTTCATTTTCAAAGCACCTCTTTGGATGATGAAGAACAACAGAGGCCACAATGTCCTGTATGCAAATCAGAAGTTTCTCAATCCTCCCTTGTTCCATTATACGGCCGTGGCCAAACCACATTACCTTCTAAAGGGAAGCCACGTCAAGTAGGCACTGTCATACCACAAAGACCTCATGGTCCAAGAACACTTAACACTAGAAGTGTTTCACAACCTATTTCTCAAAGTTACCATCCCTATAGTAATCCTTATCATCCTCAACAACACTTCAACTCGATTCCAAGCGGTTACACCTCACCTATGATTAGAACAACTGGTTCAATAGACAACACATTTGGAATCTTTGGTGAGATGATATATGCAAGGGTCTTTGGTAACCACGTGTCAAACATTCATACATACGCCAATTCGTACAATCTTTCGGGGACCAGTAACCCAAGGATGAGAAGACATTTAATGCAAGTTGATAAATCACTCAGCAGAATAAGTTGTTTCCTCCTTTGCTGCCTAGTTTTGTGTCTGCTCTTATTCTGA

>Glyma06g45850.1   sequence type=predicted peptide   gene model=Glyma06g45850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALDHFEETVHQKGNWKSSSEIIADSDRNASGDFDCNICLECVQDPVVTLCGHLYCWPCIYKWLHFQSTSLDDEEQQRPQCPVCKSEVSQSSLVPLYGRGQTTLPSKGKPRQVGTVIPQRPHGPRTLNTRSVSQPISQSYHPYSNPYHPQQHFNSIPSGYTSPMIRTTGSIDNTFGIFGEMIYARVFGNHVSNIHTYANSYNLSGTSNPRMRRHLMQVDKSLSRISCFLLCCLVLCLLLF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo