SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g45554

Feature Type:gene_model
Chromosome:Gm06
Start:48304083
stop:48306474
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g45554
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31180AT Annotation by Michelle Graham. TAIR10: myb domain protein 14 | chr2:13286806-13288175 REVERSE LENGTH=249 SoyBaseE_val: 4.00E-62ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0048 KOG Transcription factor, Myb superfamily JGI ISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_G7IRM3UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor n=1 Tax=Medicago truncatula RepID=G7IRM3_MEDTR SoyBaseE_val: 4.00E-75ISS
UniRef100_UPI0002339B8CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339B8C related cluster n=1 Tax=unknown RepID=UPI0002339B8C SoyBaseE_val: 6.00E-171ISS

Expression Patterns of Glyma06g45554
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g45554 not represented in the dataset
Glyma06g45554 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g45554
ParalogEvidenceComments
Glyma12g11330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g45554 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g300300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g45554
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g45554
>Glyma06g45554.1   sequence type=CDS   gene model=Glyma06g45554   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGTGAGAACCCCGAGCTGTGACAAAAATGGAGTGAAGAAAGGAACATGGACACCAGAGGAAGACAAGAAGTTGGTTGAGTACATTACCAGATATGGCCACTGGAATTGGCGATTACTCCCCAAGTTCGCAGGTCTTGCGAGATGTGGAAAGAGTTGCAGACTAAGGTGGCTGAATTACTTAAGGCCAAACCTCAAAAGAGGGAACTACACCAAGGAAGAGGAGGAAACTATTATCAAGCTGCACAGACATCTGGGTAACAGATGGTCTGCCATAGCTGCACGGATGCCAGGAAGAACAGACAACGAAATTAAGAACCACTGGCACACCAACCTCAAGAAGAGGTCTCAACAAGACTCAGTAGCCACAGAATCTATAGTCTCAAACTCAAATGACCAATCTCCAACTGAACAACCAACTGCAAATACTACTTTCCAAAGCTTTAACAGTACCACTCAAGATTGTTCCCCACTTTCCCAGCATTCATCACCATCCACAAGCACAGTGGTCAGCACCGAAAATCTAGTGCTGATGGAAGATGAATTTGCCTTTTGGGATTCAGACACAGATCTTATGAGTGGGAATTTCTGGCTAGAACCGTATATGCTTGATATTTCCTACGTTCCTGCTAGTGAACCTGAGTACTCTAGCCAAGTGTTTGATGTAGAACTTTGGAGCCATGATACTTAA
Predicted protein sequences of Glyma06g45554
>Glyma06g45554.1   sequence type=predicted peptide   gene model=Glyma06g45554   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMVRTPSCDKNGVKKGTWTPEEDKKLVEYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNYLRPNLKRGNYTKEEEETIIKLHRHLGNRWSAIAARMPGRTDNEIKNHWHTNLKKRSQQDSVATESIVSNSNDQSPTEQPTANTTFQSFNSTTQDCSPLSQHSSPSTSTVVSTENLVLMEDEFAFWDSDTDLMSGNFWLEPYMLDISYVPASEPEYSSQVFDVELWSHDT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo