Report for Sequence Feature Glyma06g45115
Feature Type: gene_model
Chromosome: Gm06
Start: 47913664
stop: 47913819
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g45115
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_UPI0002339B7D UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0002339B7D related cluster n=1 Tax=unknown RepID=UPI0002339B7D
SoyBase E_val: 4.00E-27 ISS
Expression Patterns of Glyma06g45115
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g45115
Paralog Evidence Comments
Glyma12g12165 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g45115 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g296400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g45115
Coding sequences of Glyma06g45115
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g45115.1 sequence type=CDS gene model=Glyma06g45115 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGAAGCTGGAAGAAATAGACAATTCCGTGTCCAAAACCAAGAAGAAGAGGAATCATGGATCCACCGGATTCTTTGTATTCGTTGATTACCTTTACCTCTTGATTTTCCTGGGTTTCCTCTGCTTCATCATCTTCAAGATTGTGGGCATCTGA
Predicted protein sequences of Glyma06g45115
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g45115.1 sequence type=predicted peptide gene model=Glyma06g45115 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAKLEEIDNSVSKTKKKRNHGSTGFFVFVDYLYLLIFLGFLCFIIFKIVGI*