Glyma06g44821 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g44821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g44821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g44821

Feature Type:	gene_model
Chromosome:	Gm06
Start:	47640114
stop:	47640865
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g44821

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G12800	AT	Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein \| chr1:4361778-4365189 REVERSE LENGTH=767	SoyBase	E_val: 3.00E-27	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0009073	GO-bp	Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process	SoyBase	N/A	ISS
GO:0009902	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast relocation	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0016117	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0034660	GO-bp	Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process	SoyBase	N/A	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
UniRef100_B9DI42	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT1G12800 protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B9DI42_ARATH	SoyBase	E_val: 4.00E-25	ISS
UniRef100_I1K6L1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6L1_SOYBN	SoyBase	E_val: 2.00E-97	ISS

Expression Patterns of Glyma06g44821

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g44821 not represented in the dataset	Glyma06g44821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g44821 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g293800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g44821

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g44821

Limit To All Plant Sequences

>Glyma06g44821.1   sequence type=CDS   gene model=Glyma06g44821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGATTGGAGCAACATGAGCAGAGACAGCTGGAGTTCCATGAGGAGCCGAATGATTTATGTCAATTGTCAGATTTAAAGTCAGATGATTCTAGAGTGGAGTTGTCTGCGGAAGCTGCGCTACAGGCAAAGCCAAAAAGACTAGATAAATATGTGAAACAAACCTCAAAATTTGTTGGAGAAGAGGGTGCTTCCCGTAATATTGGAGGTCACACAAACAATGATGATTTAGGGAAAATTGTTGATATGTCAGATTTCCAGGAAAGCGAAGATGCTGATTGGACCAGGACACGAGATTTGATTAAGACTGGAGATAGAGAAGATGTGGAACTAGTAAGCTGCAATACCAAAGGGTTCATTGTTTCTTTTGGTTCCTTGGCAGGATTTCTGCCATACCATAATCTTGCTTCCAAGTGGAAGTTCTTAGCTTCTGAGTCATGGTTAAAACAGAAGGGCTTAGATCCATCAATATAA

Predicted protein sequences of Glyma06g44821

Limit To All Plant Sequences

>Glyma06g44821.1   sequence type=predicted peptide   gene model=Glyma06g44821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GLEQHEQRQLEFHEEPNDLCQLSDLKSDDSRVELSAEAALQAKPKRLDKYVKQTSKFVGEEGASRNIGGHTNNDDLGKIVDMSDFQESEDADWTRTRDLIKTGDREDVELVSCNTKGFIVSFGSLAGFLPYHNLASKWKFLASESWLKQKGLDPSI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain