Glyma06g44125 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g44125): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g44125): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g44125

Feature Type:	gene_model
Chromosome:	Gm06
Start:	47110403
stop:	47110690
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g44125

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G29660	AT	Annotation by Michelle Graham. TAIR10: GDSL-like Lipase/Acylhydrolase superfamily protein \| chr1:10371955-10373624 FORWARD LENGTH=364	SoyBase	E_val: 4.00E-18	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
PTHR22835	Panther	ZINC FINGER FYVE DOMAIN CONTAINING PROTEIN	JGI		ISS
PTHR22835:SF39	Panther	LATERAL SIGNALING TARGET PROTEIN 2	JGI		ISS
UniRef100_G7J1P3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GDSL esterase/lipase n=1 Tax=Medicago truncatula RepID=G7J1P3_MEDTR	SoyBase	E_val: 4.00E-26	ISS
UniRef100_I1KEX0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KEX0_SOYBN	SoyBase	E_val: 1.00E-36	ISS

Expression Patterns of Glyma06g44125

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g44125 not represented in the dataset	Glyma06g44125 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g44125 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g287600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g44125

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g44125

Limit To All Plant Sequences

>Glyma06g44125.1   sequence type=CDS   gene model=Glyma06g44125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCTAAAACTAAGTCATGGGTAGTTCTATCTTTTCTTCTATTGGTTGTAATTTTAATGCAACAATGTGTCCATGGAGAATTGCAAGTGCCCTGCCTTTTTGTCTTTGGGGACTATCTGTGCGACAATGGAAATAACAAGATTCCAACAACTACAAAGTCCAATTACAAACCATATGGCATCGACTTCCCTATAGGCCCAACGGGAAGATTTACCAATGGACAAATGTCTATTGACCTAATTGGTAACAGTTTCTTTTGGTCTACAAAATATATTTTGTATTAA

Predicted protein sequences of Glyma06g44125

Limit To All Plant Sequences

>Glyma06g44125.1   sequence type=predicted peptide   gene model=Glyma06g44125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAKTKSWVVLSFLLLVVILMQQCVHGELQVPCLFVFGDYLCDNGNNKIPTTTKSNYKPYGIDFPIGPTGRFTNGQMSIDLIGNSFFWSTKYILY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain