SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g43741): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g43741): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g43741

Feature Type:gene_model
Chromosome:Gm06
Start:46766330
stop:46768540
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g43741
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G58100AT Annotation by Michelle Graham. TAIR10: plasmodesmata callose-binding protein 5 | chr3:21515397-21516329 REVERSE LENGTH=180 SoyBaseE_val: 5.00E-49ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0001872GO-mf Annotation by Michelle Graham. GO Molecular Function: (1->3)-beta-D-glucan binding SoyBaseN/AISS
GO:0030247GO-mf Annotation by Michelle Graham. GO Molecular Function: polysaccharide binding SoyBaseN/AISS
PTHR16631Panther GLUCAN 1,3-BETA-GLUCOSIDASE-RELATED JGI ISS
PTHR16631:SF1Panther GLUCAN 1,3-BETA-GLUCOSIDASE JGI ISS
PF07983PFAM X8 domain JGI ISS
UniRef100_G7JV10UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glucan endo-1 3-beta-glucosidase n=1 Tax=Medicago truncatula RepID=G7JV10_MEDTR SoyBaseE_val: 3.00E-66ISS
UniRef100_I1KEU4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KEU4_SOYBN SoyBaseE_val: 4.00E-72ISS

Expression Patterns of Glyma06g43741
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g43741 not represented in the dataset
Glyma06g43741 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g43741
ParalogEvidenceComments
Glyma12g14156 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g43741 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g284700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g43741
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g43741
>Glyma06g43741.1   sequence type=CDS   gene model=Glyma06g43741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCACCCCAAAAAGCCTCGTTCTTTCGCTCCTCCTCCTTCTGGGCCTCTGTTCCGGCGACGGCGGCGGTGGCGCTCCGCCGCAGGAGCTGTGGTGCGTGGCGAAGAACAACGCGGAGGACGCGGCGCTGCAGGCCGCGCTGGACTGGGCCTGCGGGGCCGGCGGCGCCGACTGCCGCCCAATCCAGCGCGGTGGGCCCTGCTACGACCCCACCAGCGTCCAGAATACGGCGTCGTTTGCCTTCAACGACTATTTTCTGAAACATGGCATGACCGACGATAGCTGCGACTTCAACAACAACGCTGCCGTCACTTCCTTGAACCCTAGTCATGATAATTGCAAGTTTCCCTCCGGTAAGAGTGGGAGCAATGGGAGTTTTTCTGGATCAACGCCCACTTCATCTGTTGGATTGGGACCCAGTAAAGATTTCAGTGGGTGCTCGAGAGTTTCTTGGGGATGGTGGTGGTTTTGGCCTTTGAGTTTGATCGGGCATTTGATGTTTATGGTTTCTGTTTTTGGATGA
Predicted protein sequences of Glyma06g43741
>Glyma06g43741.1   sequence type=predicted peptide   gene model=Glyma06g43741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPTPKSLVLSLLLLLGLCSGDGGGGAPPQELWCVAKNNAEDAALQAALDWACGAGGADCRPIQRGGPCYDPTSVQNTASFAFNDYFLKHGMTDDSCDFNNNAAVTSLNPSHDNCKFPSGKSGSNGSFSGSTPTSSVGLGPSKDFSGCSRVSWGWWWFWPLSLIGHLMFMVSVFG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo